KEGG   Bacillus wiedmannii: CT694_23595Help
Entry
CT694_23595       CDS       T05831                                 

Definition
(GenBank) ATP-dependent RecD-like DNA helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CT694_23595
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bwd03400]
    CT694_23595
Enzymes [BR:bwd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CT694_23595
DNA repair and recombination proteins [BR:bwd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CT694_23595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase UvrD_C AAA_12 T2SSE AAA AAA_22 AAA_16 HHH_5 AAA_29 NTPase_1 TsaE Zeta_toxin AAA_18 AAA_28 AAA_17 AAA_7 DUF4926 DEAD Rad17
Motif
Other DBs
NCBI-ProteinID: AZJ22484
UniProt: A0A3Q8RB36
Position
complement(4442590..4444926)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEDKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPDALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYKLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMGKNQLVRETMSLLNNQEGRVTEEDIVACVEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGQIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLANRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagataaaaagtttataaaagcgcaa
gttcttcacaccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgagacgaatgaaacgtacgacgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacattgacagggcattttaaagaccatccgaagtatggg
aaacaatatttagttgaaacatttaagaaagaattgccgcaaacaaaagctggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagctgaaaaaattgtg
gatcatcttggggaacatgccatctctaaaattatggatgatccagatgcgttaaacggt
gttgtcaataagcaaaaagctcaagaaatatatgagacaattgttgaacatcaaggacta
gagaaagtaatgagttttttaaatggttacggttttggaacgaagctttctattaagatt
taccagcaatataaagagatgacattagaagtgattcgtaataatccgtataagcttatt
gaagaagtggacgggattggatttggaagagcggatgatataggacgtgcgttaggtata
tcgggtaatcatgatgaccgtgtacgtgcgggttgtttttatacgttagagaatgtttca
ttgcaacttggtcatgtttatatggggaaaaatcaacttgtaagagaaacgatgtcactt
ttaaataatcaagaaggaagagtgaccgaggaagacattgtagcttgcgttgaaatgatg
caaagtgaagggaaagttatcatagaagaagaacgagtgtatttagcatcgttattctac
tcagaaaaaggtgttgtaaagtctattcgcaggcttatgaatcaggaggaaacaccctca
tttcctgaagcagaagtgttaaagacgttaggtcaaattgaagaacaactgaatgtacag
tatgcaccgtttcaacaagaagcgattcaaacggcacttcataaaccgatgatgttattg
acaggtggaccaggaacagggaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacgggctatcgttaaatccgaatgaatacagtgacgataatccatttccgata
ttattaacggccccaacaggaagagcagcgaagcgaatgagtgaatcaacagggcttcca
gcttgtacaattcaccgtttacttggctggaccccagaagggtctttccagcgtaatgaa
acggatccggtacaagggaaattgcttattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaaatcattgccgactaacattcaagttatcgttgtaggtgat
gaagatcaattaccatctgtaggacctggacaagtgttgaaagatttattgaatgcaggt
gcagttccaacagtgaagcttactgaaatttatcgtcaagcggaaggctcatctgttatt
caactcgcccatgcgataaaaaatggaacgcttccaccagatttagcgcaaaatcaaaaa
gatcgttcatttatcggctgtacaggagctcaaattgttgaggttgttaagaaggtttgt
gaaaatgctaagacaaaagggtttagcgcaagagatgtacaagtactggccccgatgtat
cgtggccctgccggtattaatgtactaaacgaagcgttgcaagaagtgtttaatccgaaa
agggaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagta
ctgcaactcgttaatcaaccggagagccaagtgtttaatggtgatatcggagaaattgtt
tcggtgttttatgcgaaagagaacgttgaacaacaagatatgattatcgtttcatttgat
ggaattgaggtaacgtatacaaagccagacttaaatcaaattacacatgcctattgctgt
tcgattcataaatcgcaaggtagtgagtttccgattgtgattatgccgatagtgaaaagt
tacaatcgtatgttacgtcgtaatttaatttacactggtattacaagaagtaaaaagttc
ctcattatttgcggggaggaagcagctttccaatctggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagcgaatcgtttgcaagaatcacaaggagaagtacagatggta
acagttaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system