KEGG   Bacillus wiedmannii: CT694_25265Help
Entry
CT694_25265       CDS       T05831                                 

Definition
(GenBank) molybdopterin (MPT) converting factor, subunit 2
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd00790  Folate biosynthesis
bwd01100  Metabolic pathways
bwd04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CT694_25265
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    CT694_25265
Enzymes [BR:bwd01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     CT694_25265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE PGAP1
Motif
Other DBs
NCBI-ProteinID: AZJ22792
UniProt: A0A3S8QF78
Position
complement(4746897..4747361)
Genome map
AA seq 154 aa AA seqDB search
MTNTYYEVIDTEISIEEVAKKVIRRECGAVTTFIGTVREFTKGRRTLYLEYVAYKTMAEK
MLEKIGSEVKEKWPGTHVAITHRIGTLQISDIAVVVAVSTPHRKAAYEANEYIMERIKQI
VPIWKKEFWEDGDSWIGDQLEKTPYPAGEPGKEL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacgtattatgaagtaattgatacagaaatctcgattgaagaggtagcaaag
aaggttattcgccgcgaatgcggtgctgttacaacatttattggaacggttagggagttt
acgaaagggcgtcgtacattatacttagaatacgtcgcttacaaaacgatggcagaaaag
atgctagagaaaattggttcagaagtgaaagagaagtggccaggtacacacgttgcaatt
acacatcgcatcggtacactgcaaatttctgatatcgcggttgttgttgctgtttcaaca
ccgcatcgtaaagcagcctatgaggcgaatgaatacattatggaacgcataaaacaaatt
gttccgatttggaaaaaggagttttgggaagatggagactcatggattggtgatcaatta
gaaaaaacgccatatccggcaggggagcctgggaaggagctgtaa

DBGET integrated database retrieval system