KEGG   Bacillus wiedmannii: CT694_30405Help
Entry
CT694_30405       CDS       T05831                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd00450  Selenocompound metabolism
bwd00970  Aminoacyl-tRNA biosynthesis
bwd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CT694_30405
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CT694_30405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bwd01007]
    CT694_30405
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bwd03016]
    CT694_30405
Enzymes [BR:bwd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CT694_30405
Amino acid related enzymes [BR:bwd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CT694_30405
Transfer RNA biogenesis [BR:bwd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CT694_30405
 Prokaryotic type
   Other AARSs
    CT694_30405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Cupin_2 tRNA-synt_1 tRNA-synt_1e AraC_binding tRNA-synt_1f MannoseP_isomer CENP-C_C Cupin_1
Motif
Other DBs
NCBI-ProteinID: AZJ23888
UniProt: A0A3S8QI98
Position
pFCC41-1-490K:complement(200904..202919)
Genome map
AA seq 671 aa AA seqDB search
MHIEKINPQIFTNEYDIMCQRLFPHSNKLYDSPFGAMWGIIEPGEISKIHGHHEVETFII
FKGEGIVKVGKKEETVTQGDAIFIPPFEEHSLKNTSDENLIFFTIWWENAFSKKNSKKLD
SGKKKYLITATPPTPNGDLHVGHLSGPYTGADILTRYLKLKGNEVFYMSGADDHQSYVPF
KAGQLEKSPRETADHFANEIEKTLRLAEINPDIFVKPHFSTFHIEFVKEFFEKLWNEGKL
VEKEVDILFCKQCDKHLYEAYVRGNCPHCDELSDGNACEKCGRPNLCIDLLNPTCKCCGS
EPVKSKIKQLFFPLSNYKTQLKQYYKELKIGPHLTALCERMLDEDFPDIPISHVSDWGIP
VPVEGYENQTIYVWFEMAPGYLSATNELIQDKNLSYTLRDFWNNQDTTIINFFGYDNGYF
HSVLFPAIWLAYSEDITLPKTMITNEFYQLEGLKFSTSRGHAVWGKELLENASHDVVRYY
LSYSRPETVETNFTMEEFNHIVDTNLNQEWESWLHDLKCKLEAESPNGAPELETLSGNYL
MYYQHVNRIMNEIMNAYEPNTFSPQKVVRLLNELVRIAKKFSAGEEFLTVLKNNQQRRNT
AIALELYTAKILALFSSPIMPTFGKMLWGDLGFNVDMQLDEEVSFLPAGQKVDLQENYFS
KTNDSFYLQNI
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgaaaagataaatccacagatttttacaaatgaatatgatattatgtgtcaa
cgattatttccgcattctaataaattatatgattcaccatttggtgcaatgtggggaatc
atagaacctggagaaatttctaaaattcatggacatcatgaagttgaaacttttattatc
tttaagggtgaaggaatagttaaagtgggtaaaaaagaagaaactgttacgcaaggggac
gccatctttattccaccatttgaagaacatagtttgaaaaatacatcagatgaaaatttg
atattcttcaccatatggtgggaaaatgcttttagtaaaaaaaatagcaagaagttagat
tcaggtaaaaagaaatatttaataacggccacaccaccaacacctaatggtgatttacat
gtagggcacctatctggtccatatacaggagctgacattttaactagatatttaaaactt
aaaggaaatgaagtcttttatatgagtggggcggatgatcatcaaagctatgtaccgttt
aaggcgggacaattagaaaaatctcctagagaaacggcagatcattttgctaatgaaatt
gaaaaaacattaagactagcagaaattaatccggatatttttgtaaaacctcatttttca
acattccacattgagtttgtcaaagagttttttgaaaaactgtggaatgaaggtaaatta
gtagaaaaagaagtcgacattctattctgtaagcaatgcgataagcacctttatgaagct
tatgtgagaggtaattgtccacattgtgatgaattatcagatggcaacgcttgtgaaaaa
tgtggtagacctaatttgtgtatagatttattaaacccaacttgtaaatgttgtggtagc
gaaccagtgaaatctaaaattaaacaactatttttcccattaagtaattataaaacacaa
ttaaaacagtactacaaagaattaaaaatagggccacatctaacggcattatgtgagaga
atgctagatgaagattttcctgatattcctatttcacatgtatctgattggggaattcca
gttccggtagaaggatatgaaaatcaaactatatatgtatggtttgaaatggcacctgga
tatttatctgcgacaaacgaattaattcaggataaaaacctttcgtatacgttaagggat
ttttggaataatcaagatacgactatcattaatttctttggatatgataatggctatttc
cattcagtgcttttcccagctatttggctagcatatagtgaagatataactcttcctaaa
acaatgataacaaatgaattttatcaactagagggtcttaagttttcaacaagtagggga
catgctgtatggggcaaagaattattagaaaatgcttcacatgatgttgtaaggtattat
ttatcttatagtagaccggaaacagttgaaacaaacttcactatggaagaatttaatcat
attgtagatacgaacttaaaccaagaatgggaatcatggttacatgatttaaaatgcaag
ttagaagctgagtctccaaatggtgctccagaattagagacactatcaggtaactattta
atgtattatcaacatgtaaatcgaattatgaatgaaattatgaatgcatatgaaccaaat
acattttcaccgcaaaaggtagttagattattaaatgaactagtcagaattgctaaaaaa
ttctcggcaggagaagaatttttaacggtattaaagaataatcaacaaagaagaaatact
gctattgcactagaattatatactgcaaaaattttagcattattttctagcccaatcatg
cctacatttggtaaaatgctatggggggatttgggatttaatgttgacatgcagttggat
gaggaagtaagctttttgcctgctggacagaaagtggatcttcaagagaattatttttca
aaaacaaacgacagtttttatcttcagaatatttga

DBGET integrated database retrieval system