KEGG   Bacillus mycoides KBAB4: BcerKBAB4_0014Help
Entry
BcerKBAB4_0014    CDS       T00642                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00230  Purine metabolism
bwe00240  Pyrimidine metabolism
bwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BcerKBAB4_0014
   00240 Pyrimidine metabolism
    BcerKBAB4_0014
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BcerKBAB4_0014
    2.7.1.76  2'-deoxyadenosine kinase
     BcerKBAB4_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Cytidylate_kin2 TsaE Thymidylate_kin AAA_33 AAA_28 AAA_29 AAA_15 CbiA AAA_25 RsgA_GTPase PRK RNA_helicase ParA AAA_16 ABC_tran IstB_IS21 AAA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ABY41283
UniProt: A9VMA3
Position
complement(22171..22839)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHYEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYDNWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccaaatgatgcagttatcactattgctggaaca
gtgggtgtcggtaaatcaactatgacaactgcattggctaacgctttaggttatcgtaca
tcttttgaaaaagtagattccaatccatatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtactttttagcagaacgatttaaagaacaaaaaagaatt
ttcgaatatggtggcggttttgttcaagaccgttctatatatgaggacactggtattttc
gcaaaaatgcattacgaaaagggtacaatgactgaaactgattatgagacatacaaaggg
ttatttgatgctatggtcatgactccttacttccctcatccagacttattaatttaccta
gaaggttcttttgatgatattgtcgatcgtattcaagaacgaggacgtcccatggagcag
caaacaccaattgaatattggaaagagatgcatggacgttacgataactggattaataac
tttaattcatgccctgttttacgattaaacattaatgaatacgatattttaaaagatggc
gattcaatcgaaccaatcattaaaaaaattggacattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system