KEGG   Bacillus mycoides KBAB4: BcerKBAB4_0075
Entry
BcerKBAB4_0075    CDS       T00642                                 

Definition
(GenBank) ATP:guanido phosphotransferase
  KO
K19405  protein arginine kinase [EC:2.7.14.1]
Organism
bwe  Bacillus mycoides KBAB4
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BcerKBAB4_0075
Enzymes [BR:bwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.14  Protein-arginine kinases
    2.7.14.1  protein arginine kinase
     BcerKBAB4_0075
SSDB
Motif
Pfam: ATP-gua_Ptrans Fe_dep_repr_C
Other DBs
NCBI-ProteinID: ABY41344
UniProt: A9VN93
Position
94175..95239
AA seq 354 aa
MSLDRIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQNEEEAKQIHELFKKK
FIKKPVEPFGEFELLKMNELNPLQRRVLVEKHLISPNLAGTEYGACLLSESEHISIMLNE
EDHVRIQCLFSGLQLSEALQSANQIDNWIEEQVEYAFDESLGYITSCPTNVGTGLRASVM
IHLPGLVLTKRINRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMTLGKSEEDIIADL
KSVIQQIIHQEKTARELIVQNSSIELEDKVYRSYGILANSRLIQSAEAATCLSDVRLGID
LGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYRRATLIRERLRIEQN
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtcactggacagaatcatgaatgaagcgattagtccatggatgaagggagatggccct
gattctgatattgttttaagtagtcgaattcgtttggctcgtaattttaaaaaatatcaa
ttctctactatgcaaaacgaggaagaagctaagcagattcatgagttatttaagaagaag
tttataaaaaaacctgtagaaccttttggggagtttgaactattaaaaatgaatgaatta
aatcctcttcaaaggagagttttagttgagaagcatttaattagtccaaatcttgcagga
acagaatacggagcatgcctactatcagaaagtgaacatataagtatcatgcttaatgaa
gaggatcatgttaggattcagtgcctattttcaggtttacagttatcagaggcgcttcaa
agtgccaatcaaatagataattggatcgaggagcaggttgaatatgcttttgatgaatcg
cttggatatattacgagttgccccactaacgtcggtacaggattaagggcttcggtaatg
attcatttgccgggactggttttaacgaaaagaattaaccgtattatacaagtaattcaa
aaattagggttagtagtaagaggaatatacggtgaaggtagcgaagcgttaggtaatata
tttcaagtgtcaaatcaaatgacactagggaaatcagaagaagatattattgcagattta
aagagtgtcattcaacaaatcatccatcaagaaaaaacggctagagaattaattgtacaa
aattcaagcattgagcttgaagataaagtatatcgttcttacggaatactagctaacagt
cgtttaattcaatctgcagaagcagccacttgcttatcagatgtacggcttggtattgac
ttaggatatatacaaggtatatcgagaaatattttaactgagttaatggttcttactcag
ccaggcattttgcaacaatatgcaggaggacctttaggaccagaagaaagagattatcga
agagcaaccttaatccgtgagcgattacgaattgaacaaaattaa

DBGET integrated database retrieval system