KEGG   Bacillus mycoides KBAB4: BcerKBAB4_0589Help
Entry
BcerKBAB4_0589    CDS       T00642                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BcerKBAB4_0589
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BcerKBAB4_0589
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BcerKBAB4_0589
    1.1.1.-  
     BcerKBAB4_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N Gp_dh_N OxoDH_E1alpha_N
Motif
Other DBs
NCBI-ProteinID: ABY41854
UniProt: A9VEV5
Position
678741..679793
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVRPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVIGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactactttggcataatcaacgtgatgtacgagtagaagaagtaccagaacca
actgtaagaccaggagcagttaagattaaagttaaatggtgtggtatctgcggaacagac
ttgcatgaatatttagcaggacctatttttattccaacagaagagcacccattaacacac
gtaaaagcaccggttattttaggtcatgagtttagtggtgaggtagttgaaatcggtgaa
ggcgttacttctcataaagtgggagatcgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacacggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggtccac
catattcctgatgaaatgacgtatgaacaaggtgcacttgtagaaccagcagcagtagca
gttcatgcagtacgtcaaagtaaattaaaagagggggaagctgtagcggtatttggttgt
ggtccgattgggcttcttgtaatccaagcagcaaaagcagcaggagcaactcctgttatc
gcagtggaactttctaaagaacgtcaagagctagctaaattagcaggtgctgattacgta
ttaaatccagcaactcaagatgtactagcagaaattcgtaacttaacaaatggtttaggt
gtaaatgtgagctttgaagtaacaggtgtcgaagtagtacttcgtcaagcgattgaaagt
acaagctttgaaggacaaactgtaattgttagtgtgtgggaaaaagatgcgacaattacg
ccaaacaatcttgtactaaaagaaaaagaagttattggtattcttggataccgtcatatc
ttcccagctgttattaaattaattagctctggccaaattcaagcagagaaattaattacg
aaaaaaatcacagtagatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system