KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1147Help
Entry
BcerKBAB4_1147    CDS       T00642                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01130  Biosynthesis of antibiotics
bwe01230  Biosynthesis of amino acids
Module
bwe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BcerKBAB4_1147
Enzymes [BR:bwe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BcerKBAB4_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABY42396
UniProt: A9VJW0
Position
1217027..1217788
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVEQKKVEVAELYETYSPVKEKRKTHSLVKALEQFTVIAEVKRASPSKGDINL
HVDVPKQVKTYEECGAGAVSVLTDGQFFKGSFHDLETARAESNIPLLCKDFIIDKIQIDR
AYEAGADLILLIVAALSKEKLNELYNYVLEKGLEAIVEVHDEQELEIAIRLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEENLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SISNFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggggacgattttagacaaaattgtagagcaaaagaaagtggaagttgcggagttatat
gaaacatattcaccagtgaaagaaaaaaggaaaacacactcacttgtaaaagctttagaa
cagtttactgtaatagcagaggtaaagcgagcgtctccatcaaaaggcgatattaattta
cacgttgatgtgccaaaacaagtgaaaacatatgaagaatgcggtgctggagcagtttcg
gttttaacagacggtcaattttttaaagggtcgtttcacgacttagaaacggcaagagca
gaaagtaacattccgcttttatgtaaagattttataatcgataaaatccaaattgataga
gcgtatgaagcaggagcagatcttattttattaattgttgcagcattgtcaaaagagaaa
ttaaacgagctttataactacgtgctagaaaaaggattagaagcgattgttgaagttcat
gatgaacaggaattagaaattgcaatccgattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacatttgaagtagatttaagccaaactgaaaagctcggaaaacgactg
aatgaggaaaacctactttggattagtgaaagcggcattcattcaaaagaagatattatt
cgcgtcaaacgagctggtgcaaaaggtgtattagttggagaagcacttatgacatcatct
tctataagtaactttttcgaagactgtaaggtgaacatatga

DBGET integrated database retrieval system