KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1435Help
Entry
BcerKBAB4_1435    CDS       T00642                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00790  Folate biosynthesis
bwe01100  Metabolic pathways
Module
bwe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BcerKBAB4_1435
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BcerKBAB4_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI BCDHK_Adom3
Motif
Other DBs
NCBI-ProteinID: ABY42682
UniProt: A9VMC0
Position
1486282..1486851
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgtcttattttagaggcaatc
ggagatgacccaaatcgcgagggagtacttgatacaccgaaacgtgttgcgaaaatgtac
gcagaagtattctcaggaatgcatgaggatccgaaagagcatttacacaaagtattcgga
gaagaccacgaagagcttgtgctagtaaaagatataccattctattcgatgtgtgagcat
catcttgttccgttttatggagttgctcacgttgcatatattccgcaaggtggaaaagta
acgggactaagtaaattagctcgtactgtagacacaattgcgcgtcgtccgcaactacaa
gaacgtattacatcaacagtagctaactctattatggaagtactagagccgcatggtgta
atggtagtagtagaagcagagcatatgtgtatgacgatgcgtggtgtgaaaaagcctggt
gcgaaaacagtaacgactgcagtgcgcggcgtgttagaaaatgatgcagcagcacgtagt
gaaattttatcgtttattaagacgaattaa

DBGET integrated database retrieval system