KEGG   Bacillus mycoides KBAB4: BcerKBAB4_1952Help
Entry
BcerKBAB4_1952    CDS       T00642                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00670  One carbon pool by folate
bwe01100  Metabolic pathways
bwe01120  Microbial metabolism in diverse environments
bwe01200  Carbon metabolism
Module
bwe_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BcerKBAB4_1952
Enzymes [BR:bwe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BcerKBAB4_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ABY43183
UniProt: A9VSU4
Position
2008010..2009761
Genome map
AA seq 583 aa AA seqDB search
MQKIQKTDTISSESIKGGLGYMTTTTTVKSDIEIAQEASMKKIQEIAANLNILEEELEPY
GHYKGKLSLDIFKRLQDEKDGKVVLVTAINPTPAGEGKSTVTVGLGQAFNKIGKKTVIAL
REPSLGPTMGLKGGAAGGGYSQVVPMEDINLHFTGDIHAITTANNALAAFIDNHIQQGNT
LGIDTRKIVWKRCVDLNDRALRNVVIGLGGPVQGVPREDGFDITVASEIMAVFCLATDIQ
DLKSRLSRIVVAYNFSNQPVTVKDLGVEGALTLLLKDALKPNLVQTLENTPAIIHGGPFA
NIAHGCNSVIATTMAAKLGDYVITEAGFGADLGAEKFLDIKARAAGIKPEAVVIVATIRA
LKMHGGVARDQLKEENVDALAKGMENLQKHVETIQSFGVPFVIAINKFITDTDAEVAYLQ
EWCNERGYAVSLTEVWEKGGQGGVDLAEKVLKEIEKGENNYAPLYELELPLEEKIRTIAQ
KVYGAKDIEFAPKARKQLAQYEGEGWSNLPICMAKTQYSLSDDATKLGRPSDFIVTIREL
KPSIGAGFIVALTGTMLTMPGLPKQPAALQMDVNEDGKAVGLF
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaatacaaaaaactgatacaatatcatcagaatcaattaaagggggactaggg
tatatgacaactactacaacagttaaatctgatattgaaatcgcacaagaagcaagtatg
aagaagattcaagaaattgcagctaatttaaatattttagaagaagaactagagccatac
ggacattataaaggcaagttatctcttgatatttttaagcgtttacaagatgagaaagac
ggtaaagttgttttagtaacagcgattaacccaactccagcaggagaaggtaaatcaaca
gtaacagttggtttaggtcaagcttttaataaaattggtaagaaaacagtaattgcactt
cgcgaaccatctcttggaccaacaatgggattaaaaggcggagcagcaggtggtggttat
tctcaagtagtaccaatggaagatattaaccttcactttactggagatattcatgcgatt
acaactgccaataacgcattagcggcgttcattgataatcatatccaacaaggaaacaca
cttggaattgatacgcgtaaaatcgtttggaaacgctgtgttgacttaaatgatcgtgcc
cttcgtaatgtagtaattggccttggtggaccggttcaaggtgtaccacgtgaagatggt
tttgatattacagtagcatctgaaattatggccgtattctgccttgcaacagatattcaa
gatttaaaatcacgtctatctcgcattgttgtcgcttataatttttcaaatcaacctgta
acagttaaagatttaggagtagaaggagcgttaacacttctattaaaagatgcattaaaa
ccgaacttagtacaaacattagaaaatacaccagctatcattcatggcggaccatttgcg
aatatcgctcacggttgtaacagtgttatcgctacgacaatggcagcaaaattaggtgat
tatgttattacagaagctggattcggtgcagatttaggtgccgagaagtttttagatatt
aaagcacgtgcagctggtattaaaccagaagcggtagttattgttgcgactattcgtgcg
cttaaaatgcacggtggtgttgcgagagatcaattaaaagaagaaaatgtagatgcgtta
gcaaaaggtatggagaacttacagaagcatgttgaaacaattcaaagcttcggtgttcct
ttcgtaattgccattaacaaattcattactgatacagatgcagaagttgcatacttacaa
gaatggtgcaatgagcgtggctatgcagtatccttaacagaagtttgggagaaaggtggc
caaggcggagttgaccttgctgagaaagtgttaaaagaaattgaaaaaggtgaaaacaac
tacgcaccactttatgaattagaattaccattagaagaaaaaattcgtacaattgctcaa
aaagtgtacggcgcaaaagatattgaatttgctccgaaagcacgtaagcaattagctcaa
tatgagggagaaggttggagtaacctaccgatttgtatggcgaaaacacaatactctctt
tcagatgatgcaacaaaattaggtcgcccatctgactttatcgttacaattcgtgaatta
aaaccatctatcggtgcagggtttatcgttgcgttaacaggaacaatgttaacaatgcca
ggccttccaaaacagccagctgcgctgcaaatggatgtaaatgaagatggaaaagcagta
ggtttattctaa

DBGET integrated database retrieval system