KEGG   Bacillus mycoides KBAB4: BcerKBAB4_2170Help
Entry
BcerKBAB4_2170    CDS       T00642                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00473  D-Alanine metabolism
bwe01100  Metabolic pathways
bwe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BcerKBAB4_2170
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BcerKBAB4_2170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bwe01011]
    BcerKBAB4_2170
Enzymes [BR:bwe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BcerKBAB4_2170
Peptidoglycan biosynthesis and degradation proteins [BR:bwe01011]
 Precursor biosynthesis
  Racemase
   BcerKBAB4_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABY43391
UniProt: A9VF15
Position
2230583..2231779
Genome map
AA seq 398 aa AA seqDB search
MNVNYGRHTIIEVDLNALQRNFQQYKQAIPFGTAIMTVVKANAYGHGAVPIAKAVIEAGT
SHLAVAFVDEGIELREAGITVPILIFGYTPYEAIVDAITYDLSMTVYTIEDLHAIEEVAS
QMEKNAYIHIKIDTGMSRIGLQLNEVTLFLQTLKCTKYIQVEGMYTHFACADERDKAYTL
MQQEVFQKAVSKAEELQIVIPWIHANNSAATIDMRETKGNMVRLGIALYGLYPSADVNQE
AISLQPILTFKSKVAHIKKVKKGNGVSYGATYTATGEEWIATIPVGYADGVSRQLSNKGF
VLIKDVKVPIIGRICMDQLMLDVTKIMPIHVGDEVVFYGNQGEESISVDCVADTLSTINY
EITCMLSRRIPRIYIKDNKPIEIINELRRSPISLCINE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttaactatggtagacatactattattgaagttgatttaaatgcactgcaacgt
aatttccaacagtacaaacaagctattccatttggtacagcgattatgacagttgtaaaa
gcgaatgcctatggacacggggcagttccgattgcgaaggcggtaatagaggcaggcaca
agtcacttggcagttgcgtttgtagatgaaggaattgaacttagagaagctggtataact
gtaccaatattaatctttggatacacaccgtatgaagcgatagtagatgcaattacgtat
gatttaagcatgacagtatatacaattgaggatttgcatgctatagaagaggttgcttca
caaatggaaaagaatgcgtacatccatattaaaattgacactggaatgagccgaatcggt
ttacaacttaatgaagtcacattgtttttacaaacattaaagtgtacaaaatatattcag
gttgaaggaatgtacacgcacttcgcttgtgcagatgaaagggataaagcatatactctc
atgcaacaagaggtattccaaaaagccgtaagcaaagcagaagagttacaaattgttatt
ccatggattcatgccaataatagtgctgctacaattgatatgagagaaacaaaaggaaat
atggtccgccttggaatcgcgttatacggtctctatccatctgcagatgtcaatcaagaa
gctatttcgttacagcctatcctgacatttaaatcaaaagttgcgcatatcaaaaaagta
aaaaaaggaaatggggttagctatggagcaacatacacagcgacaggagaagaatggatt
gcgacgataccggttggatatgcggatggtgtcagcaggcaactctcgaataaagggttt
gtattaataaaggatgtgaaagttcctattataggacgtatttgtatggaccagttaatg
ttggacgtaacaaaaatcatgccaatacatgttggggatgaggtggtcttttatggtaat
caaggcgaggaatcaataagtgtagattgcgttgcagatacattaagtacaattaattat
gagattacttgtatgttaagtagaaggatacctcgcatctatataaaagacaataagcca
atcgaaataataaatgaactacgaagaagtcctatcagtttatgtataaatgaatga

DBGET integrated database retrieval system