KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3531Help
Entry
BcerKBAB4_3531    CDS       T00642                                 

Definition
(GenBank) Beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00010  Glycolysis / Gluconeogenesis
bwe00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcerKBAB4_3531
   00500 Starch and sucrose metabolism
    BcerKBAB4_3531
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BcerKBAB4_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ABY44704
UniProt: A9VS04
Position
complement(3578990..3580399)
Genome map
AA seq 469 aa AA seqDB search
MKFPHDFLFGAASASYQVEGAWNEDGKGVTNWDEFSKIPGKTYDGTNGDVAVDHYHRYKE
DVRLMAEMGLESYRFSISWARILPTGDGEVNEKGIEFYNNLIDECLKYGIVPFATLYHWD
LTLPLEKDGGWTNKRTAEAFVKYAEICFKAFGDRVKHWITFNETVMFCGLGYLKGAHPPG
IQNDVPKYFQATHYVFYAHAKTVAVYKQLKQYGEIGITHVFLPAYSVDDQKENILAANHA
NEYETYWYYDPVLKGEYPSYVVQQLKENGWTPNWTVEELEIIKQNAEKNDFIGLNYYQPI
RVERYDMDIKSEEHSRENSTLAPGNPSFDGFYRTVKMDDKTYTKWGWEISPEGFLDGLHM
LKARYGDIKMYVTENGLGDEDPIIDGEIVDVPRIKFIEEHLKVMKCAIQEGINLKGYYAW
SVIDLLSWLNGYKKQYGFIFVDHNDNLKRKKKLSFHWYKHVIETRGEEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccacatgattttttattcggagctgcttcagcttcttatcaagtagaaggt
gcatggaatgaggatggaaaaggtgttacgaattgggatgagttttcaaaaattcctggc
aaaacatacgatggaacaaatggtgatgtagcggttgatcattatcatcgatataaggaa
gatgttcgtttaatggctgagatgggattggaatcgtatcgtttttcgatttcttgggcg
agaatattgccgactggagatggagaggtaaatgaaaaaggaattgaattttataacaat
ttaattgatgaatgtttaaagtacgggattgtaccgtttgccactttatatcattgggat
ctaacattaccgttagaaaaagatggtgggtggacgaataaacgaacagcagaggctttt
gtaaagtatgcagaaatttgctttaaggcatttggtgatagagtgaaacattggattact
tttaatgaaacagtaatgttttgtggattaggctatttaaaaggtgcacatccaccagga
atacaaaatgatgttccaaagtattttcaagcgactcattatgtattttatgcgcatgcg
aaaacagttgcggtgtacaagcagctgaaacagtatggggagatagggattacacatgtt
ttcttacctgcttatagtgtggatgatcaaaaagaaaatatactagcagcaaatcatgcg
aatgaatatgaaacgtattggtactacgatccagttttaaaaggtgagtatccgtcttat
gttgtacaacaattaaaggaaaatgggtggactcctaattggacggttgaagaattagaa
atcattaaacaaaatgccgaaaaaaatgattttattggcttgaattattatcagccaata
cgagtagaaagatatgatatggatataaagagcgaggagcattctcgagaaaactcaaca
cttgctccaggtaatccttcttttgatggtttttatcgaacagtaaaaatggatgataaa
acatataccaaatggggttgggaaatatctcccgaaggtttcttagatggattgcatatg
ttgaaagcgcgttacggtgacataaagatgtatgtaacggaaaatggacttggtgatgaa
gatccaatcattgacggagaaattgtagatgttccgcgaattaaatttattgaagagcat
ttaaaagtaatgaagtgtgcaattcaagagggaattaatttaaaaggttattatgcatgg
tcagttattgatttgttaagttggttaaatggatataaaaagcaatatggctttattttt
gtcgatcataatgataacttaaaacgtaagaagaaactttcgtttcattggtataaacat
gtgatcgaaacgagaggagaagagttataa

DBGET integrated database retrieval system