KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3644Help
Entry
BcerKBAB4_3644    CDS       T00642                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00900  Terpenoid backbone biosynthesis
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01130  Biosynthesis of antibiotics
Module
bwe_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bwe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BcerKBAB4_3644
Enzymes [BR:bwe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BcerKBAB4_3644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABY44815
UniProt: A9VT59
Position
complement(3695659..3696801)
Genome map
AA seq 380 aa AA seqDB search
MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNVDYAVKVIQEFSPQIVSVQREE
DVLKLQAVSGNTKVVYGSEGLLEVALHPDTEIVVNAVVGSVGLLPTLRAIEAKKTIGIAN
KETLVTAGHLVMEAARKNNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKT
RDELHQVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKES
IIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTKQLNLWEMGTLHFEKMNQE
RFRCLRFAYEAGKTGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMHHHTVIARP
SLEEIQEIDAATRRFVMEQI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattagtttactaggtgcaagcggatcaatcggtacacaaacattagatgtg
ttacgctcgcacccagaccaattccgtctcgttgctttttctgtagggaaaaatgttgat
tatgcagtaaaggtaattcaagaattttccccgcaaattgtctctgtgcaaagagaggaa
gatgttttaaaattacaagctgtttctggtaatacaaaagtagtatatggtagcgaaggc
ttattagaagtagcgctgcacccagatacagaaattgtagtgaatgctgttgtaggtagc
gtagggttgttaccgacactccgcgcaattgaggcgaaaaaaacaattggaattgcaaat
aaagaaacgttagtaactgcagggcatcttgtaatggaagcagcacgaaaaaataatgta
tcgttacttccagtagacagtgaacattcagcgatttttcaatgcttgaatggtgaaaat
gaaaaaagaatctctcgcttaattataactgcttcaggcggaagttttcgtgataaaacg
agagatgaattgcatcaagtgaccgtagaagatgcacttcgtcatccaaactggtcaatg
ggttcgaaaattacaattgattctgctacaatgatgaataaggggctagaagtaattgaa
gcacactggctttttggtatcccttatgagcaaatcgatgttgttctacataaagaaagt
attattcattctatggttgaatttgaagatcgtagtgtaatggcacagcttggctcacct
gatatgcgagtaccgattcaatacgcgcttacatatcctgatagattgcctctttcagac
acgaaacagttaaatttatgggaaatgggaacattgcattttgagaaaatgaatcaagag
cgtttccgttgtctacgttttgcgtatgaagctggaaagacaggtggaagtatgccggct
gtaatgaacgcggcaaatgaagtagctgttgaagcttttttacaaaagagaattggtttc
ttaacagtggaagacctcattgaaaaagcaatgcaccatcacactgtcattgcacgtccg
agcttagaggaaattcaggaaattgacgcagccacaagacggtttgtgatggaacaaatt
tag

DBGET integrated database retrieval system