KEGG   Bacillus mycoides KBAB4: BcerKBAB4_3866
Entry
BcerKBAB4_3866    CDS       T00642                                 

Definition
(GenBank) 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00270  Cysteine and methionine metabolism
bwe01100  Metabolic pathways
Module
bwe_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BcerKBAB4_3866
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     BcerKBAB4_3866
SSDB
Motif
Pfam: HAD UMPH-1 Hydrolase HAD_2
Other DBs
NCBI-ProteinID: ABY45034
UniProt: A9VFE0
Position
3909948..3910607
AA seq 219 aa
MSIQVFCDFDGTITNNDNIMSIMEKFAPPEAEEIKQKILSQELSIQEGVSQLFRLIPINL
HDDIIQFLQETAEIRTGFHEFIQFINENNISFYVISGGMDFFVYPLLQEIIPKEQIYCNA
TDFSGEFVEVKWPHPCDEQCQHSCGLCKSSLIRKLSSKDDFHIVIGDSITDLQATKQADK
VFARDFLITKCEENRIAYTPFETFHDVLAELKHLLEVKL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtattcaagtattttgtgatttcgatggtacgattacaaataacgataatatcatg
tccattatggaaaaattcgcaccaccagaagcagaggaaataaagcaaaaaattttatcg
caagaactttctattcaagaaggtgtttctcaattgtttcgattaatacctattaatcta
cacgatgatattattcagtttttacaagaaactgctgaaatccgtacaggttttcatgaa
ttcatacaattcattaatgaaaataacatttccttttacgttatatcaggtggaatggat
ttcttcgtctatccactcttacaagaaataatccctaaagaacaaatttattgtaatgca
actgacttttcaggagaatttgttgaagtgaaatggccgcacccttgtgacgagcaatgt
cagcatagttgtggtctctgtaaatcatcattaattcgtaaactaagctctaaagatgat
tttcatattgtgattggagattctattactgatttacaagcaacaaaacaagcagataaa
gtattcgcccgtgacttccttattacaaagtgtgaagaaaatcgtattgcttatacaccg
tttgaaacatttcacgatgttctagctgaactaaaacatttgttggaggtgaaattatga

DBGET integrated database retrieval system