KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4249Help
Entry
BcerKBAB4_4249    CDS       T00642                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00970  Aminoacyl-tRNA biosynthesis
Module
bwe_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BcerKBAB4_4249
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bwe01007]
    BcerKBAB4_4249
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bwe03016]
    BcerKBAB4_4249
   03029 Mitochondrial biogenesis [BR:bwe03029]
    BcerKBAB4_4249
Enzymes [BR:bwe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BcerKBAB4_4249
Amino acid related enzymes [BR:bwe01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BcerKBAB4_4249
Transfer RNA biogenesis [BR:bwe03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BcerKBAB4_4249
 Prokaryotic Type
   Other AARSs
    BcerKBAB4_4249
Mitochondrial biogenesis [BR:bwe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BcerKBAB4_4249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b HD_3
Motif
Other DBs
NCBI-ProteinID: ABY45408
UniProt: A9VIM8
Position
complement(4244028..4245803)
Genome map
AA seq 591 aa AA seqDB search
MAERTHACGKVTVEAVGQTVQLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPETSKEAL
EVAETIRSEYVLHVEGTVVERGEGAINDNMATGRIEVQASKVNVLNAAKTTPIIIADDTD
ASEDVRLKYRYLDLRRPAMFNTFKMRHDVTKTIRNFLDTEEFLEVETPILTKSTPEGARD
YLVPSRVHDGEFYALPQSPQLFKQLLMVGGFERYYQVARCFRDEDLRADRQPEFTQIDIE
ASFLTQDEILEMMERMMTKVMKDAKGVEVSAPFPRMKYADAMARFGSDKPDTRFEMELKD
LSEFAVGCGFKVFTSAVENGGQVKAINAKGAASKYSRKDIDALTEFAKVYGAKGLAWLKV
EEDGLKGPIAKFFGEEEANVLMSTLEADAGDLLLFVADKKSVVADSLGALRLRLGKELEL
IDESKFNFLWVTDWPLLEYDEDADRYFAAHHPFTMPFREDVELLETAPEKARAQAYDLVL
NGYELGGGSLRIYERDVQEKMFKALGFSQEEAQEQFGFLLEAFEYGTPPHGGIALGLDRL
VMLLAGRTNLRDTIAFPKTASASCLLTEAPSPVAEAQLEELSLKLSLKEEK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagaacacatgcatgcggaaaagtaacagtagaagcggttggacaaacagtt
caattaaaaggttgggtacaaaaacgccgtgatttaggcggattaatctttatcgactta
cgtgaccgtacaggtatcgtacaagttgtatttaatccagaaacatcaaaagaagcgtta
gaagtagcagaaacgattcgtagcgaatacgtattgcacgtagaaggtacagttgttgaa
cgtggtgaaggcgcaattaatgataatatggcaactggtcgtattgaagtacaagcatcg
aaagtaaatgtattaaacgcagcgaaaacaacgccaatcattattgctgatgatacagat
gcatcagaagatgtgcgtttaaaatatcgttacttagacttacgtcgtcctgcaatgttc
aacacattcaaaatgcgtcatgacgtaacgaaaacaattcgtaacttcttagatacagaa
gagttcttagaagttgaaacaccaattttaacgaagagcacgccagaaggagctcgcgac
tatttagtaccaagccgtgtgcatgatggtgaattttatgcattacctcaatctccgcag
ctatttaaacagcttcttatggtcggtggatttgagcgttactatcaagtagcacgttgt
ttccgtgacgaagatttacgtgcggatcgtcaaccggaattcacgcaaattgatatcgag
gcatcattcttaacacaagatgaaattttagaaatgatggagcgtatgatgacgaaagtc
atgaaggatgcaaaaggtgtagaagttagtgcaccattccctcgtatgaaatatgctgat
gcaatggctcgctttggttctgataagccggatacacgctttgaaatggaactaaaagac
ctatctgaatttgcagtaggttgtggatttaaagtatttacaagtgctgtagaaaacggc
ggacaagtaaaagcgattaacgcaaaaggtgcagcgagcaaatactctcgtaaagacatc
gatgcattaactgaattcgccaaagtatacggtgcaaaaggtctagcttggcttaaagtt
gaagaagacggcttaaaaggaccgattgcgaaattcttcggtgaagaagaggcaaacgtg
ttaatgagtacattagaagcggatgctggtgacttattactattcgtagcagataagaaa
agtgttgttgcagatagcttaggtgcacttcgtttacgtctaggtaaagaacttgagtta
attgacgaaagtaaatttaacttcctatgggtaactgattggccacttcttgagtacgat
gaagatgcagatcgttacttcgcagctcaccacccattcacaatgccattccgtgaagac
gttgagttattagaaacagcaccagaaaaagcacgtgcacaagcatatgaccttgtatta
aacggttatgagcttggtggtggatcacttcgtatctacgagcgtgacgtacaagaaaaa
atgttcaaagcacttggattctcacaagaagaagcacaagaacaattcggattcttatta
gaagcattcgaatacggtacaccaccacacggcggaatcgcattaggtttagaccgtctt
gttatgttacttgcaggtcgtacgaaccttcgtgatacaattgcattcccgaaaacagca
agcgcaagctgcttattaacagaagcgccaagcccagttgcagaagctcagcttgaagag
ctaagcttaaaattgagcttgaaagaagagaagtaa

DBGET integrated database retrieval system