KEGG   Bacillus mycoides KBAB4: BcerKBAB4_4743
Entry
BcerKBAB4_4743    CDS       T00642                                 

Definition
(GenBank) Leucyl aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00480  Glutathione metabolism
bwe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BcerKBAB4_4743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bwe01002]
    BcerKBAB4_4743
Enzymes [BR:bwe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     BcerKBAB4_4743
Peptidases and inhibitors [BR:bwe01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   BcerKBAB4_4743
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Other DBs
NCBI-ProteinID: ABY45893
UniProt: A9VMY8
Position
complement(4723832..4725316)
AA seq 494 aa
MFRVQKELVSHEAVIVALFEEDKKSSFVQELDKAFEGQLQVLLEEKELSTKKKAISKVHS
LGKTNVKRYYFVGLGKKESYTTETLRAALGKAFKALQAAKVQDAAILLDSFVTDKLDAID
VAHIAAEVQGLGTYELQTYKADKKDRVELEKFTAITAEDAQEIEAALTVGYVHGRATNSA
RTLVNMPPNVLTATKLAEYAVELAEKYDMDYKVLEKEEMEELGMGALLAVNQGSTEPPKM
IALIYKGKEEWKDVIGFVGKGITYDTGGYSLKPREGMVGMKGDMGGAAAVLGAMEIIGEL
RPEQNVIAVIPSTDNVVSGTAFKPDDVITSMSGKTIEVLNTDAEGRLALADGITYAKKLG
ANYLVDVATLTGGVIVALGNHTTGAMTNNEELFEQVLEASMETDEPIWQLPIFERDKERV
KNSKFADLNNSPGREGHAVMAGTFIGEFAEETPWVHLDIAGTSETSGAHDLGPSGATGAM
VRTLATLVERFGEE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtttcgagtacaaaaagaattagtaagtcatgaagcggtaattgttgccttatttgaa
gaagataaaaagagtagctttgtacaagaactggataaagcgtttgaaggacaattacaa
gttttattagaagaaaaagaactttcaactaagaagaaagcaatttcaaaagtacatagc
ttaggaaaaacaaatgttaaacgttattattttgttggtttaggtaagaaagagtcatat
acaacggaaacgttacgtgctgctcttggtaaggcgtttaaagcgttacaagcagcaaaa
gtacaagatgcagcaatcttacttgattctttcgtgacagataaattagatgcgattgat
gtagctcatattgcggcagaagtacaaggtcttggtacatatgaattacaaacgtataaa
gcagataaaaaggatcgtgtagaattagagaagtttacggctattacagcagaagatgca
caagaaattgaagcagcattaacggtaggatacgtacatggacgtgcaacgaattcagct
cgtacgcttgtaaatatgccgccaaacgtattaacagcgacaaagcttgctgagtatgca
gttgaattagcagaaaaatacgatatggattataaggttcttgagaaagaagagatggaa
gagcttggtatgggtgcattacttgcagtaaaccaaggatctactgaaccgccaaaaatg
atcgctcttatttataaaggaaaagaagagtggaaagatgtaattgggtttgttggaaaa
gggattacatatgatacaggcggttattctttaaaaccacgtgaaggcatggttggtatg
aaaggtgatatgggcggagctgcagctgttcttggcgcgatggagatcatcggtgaactt
cgccccgagcaaaatgtaattgctgttattccatcaactgacaacgttgtaagtggtaca
gcatttaagccagatgatgttattacatctatgagcggaaaaacaattgaagtattaaat
acagatgcagaaggtcgcctagcgttagctgacggtattacgtatgcgaagaaacttggc
gcaaattacttagttgatgttgcaacattaacaggcggtgtaattgttgcacttggaaat
catacaacaggcgcgatgacaaataatgaagaattgtttgaacaagtgttagaggcttct
atggaaacggatgagccaatttggcaattgccgatttttgaacgtgataaagaacgtgtc
aaaaacagtaaatttgctgatttaaataactcaccaggccgtgaaggacatgcggttatg
gctgggacattcattggtgaatttgcagaagaaacaccatgggtacacttagacatcgct
ggaacatctgaaacatcaggagcacatgatttaggaccatctggagcaacaggtgcaatg
gtgcgtacacttgcaacacttgttgagcgtttcggagaagaataa

DBGET integrated database retrieval system