KEGG   Bacillus mycoides KBAB4: BcerKBAB4_5142Help
Entry
BcerKBAB4_5142    CDS       T00642                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bwe  Bacillus mycoides KBAB4
Pathway
bwe00071  Fatty acid degradation
bwe00072  Synthesis and degradation of ketone bodies
bwe00280  Valine, leucine and isoleucine degradation
bwe00310  Lysine degradation
bwe00362  Benzoate degradation
bwe00380  Tryptophan metabolism
bwe00620  Pyruvate metabolism
bwe00630  Glyoxylate and dicarboxylate metabolism
bwe00640  Propanoate metabolism
bwe00650  Butanoate metabolism
bwe00900  Terpenoid backbone biosynthesis
bwe01100  Metabolic pathways
bwe01110  Biosynthesis of secondary metabolites
bwe01120  Microbial metabolism in diverse environments
bwe01130  Biosynthesis of antibiotics
bwe01200  Carbon metabolism
bwe01212  Fatty acid metabolism
bwe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bwe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BcerKBAB4_5142
   00630 Glyoxylate and dicarboxylate metabolism
    BcerKBAB4_5142
   00640 Propanoate metabolism
    BcerKBAB4_5142
   00650 Butanoate metabolism
    BcerKBAB4_5142
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BcerKBAB4_5142
   00072 Synthesis and degradation of ketone bodies
    BcerKBAB4_5142
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BcerKBAB4_5142
   00310 Lysine degradation
    BcerKBAB4_5142
   00380 Tryptophan metabolism
    BcerKBAB4_5142
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BcerKBAB4_5142
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BcerKBAB4_5142
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BcerKBAB4_5142
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bwe04147]
    BcerKBAB4_5142
Enzymes [BR:bwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BcerKBAB4_5142
Exosome [BR:bwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BcerKBAB4_5142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABY46288
UniProt: A9VSE2
Position
complement(5106700..5107881)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGTLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETINKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIQQRKGDPIVVAKDEAPRADTTIEKLAKLKPVFDKTS
AVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINEL
LKKTGKTIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccggttggaaaatttggaggaact
ttaaaagacgtgaaagcaacagagcttggaggaatcgcaattaaggcagcgcttgaaagg
gcgaatgtttccgctagtgatgttgaagaagttatatttggaacggttatccaaggaggg
caaggacaaattccatcacgccaagcagcaagagcggccggcattccttgggaagtgcag
acagaaacaataaataaagtttgtgcatcagggcttcgcgcagttacgttagcagatcaa
attattcgtactggtgatcaatcactgattgtagctggtggaatggaatcgatgagtaac
agcccttacattttacgaggcgcaagatggggatacagaatgggtaacaacgaagttatc
gatttaaacgttgcagacggtttaacatgcgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaagatggaatctctcgcgaagcacaagatgaatgggcatat
cgtagccatcaacgtgcggtttcggcacataaagaagggcgttttgaagaggagattgta
ccagtaacaattcagcaaagaaaaggcgatcctatcgtcgtggctaaggatgaggcacca
cgcgcggatacaacgattgaaaaattagcgaaattaaagcctgtatttgataagacgtca
gcggtgacagcaggtaatgctccgggactaaatgatggcggtgctgcacttgtattaatg
agcgaggacagagcgaagcaagaaggaagaaaaccattagcgacaattttggcgcatacg
gcgattgcggtagaatcgaaggatttcccaagaacgccaggttatgcaattaatgaattg
ctgaaaaagacaggtaagacaattgaagacatagatctatttgaaatcaatgaggcattt
gcggctgtagcaattgcaagtacagaaatcgcagggatcgatccggaaaaattgaatgta
aatggcggtgctgtagcaatggggcatccaattggagcgagcggagcacgtattatcgtt
acacttatccatgcactgaagcagcgcggcggcggaattggaattgcttctatttgtagc
ggtggcggtcaaggtgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system