KEGG   Bacillus weihaiensis: A9C19_01630Help
Entry
A9C19_01630       CDS       T04822                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00051  Fructose and mannose metabolism
bwh00520  Amino sugar and nucleotide sugar metabolism
bwh01100  Metabolic pathways
bwh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A9C19_01630
   00520 Amino sugar and nucleotide sugar metabolism
    A9C19_01630
Enzymes [BR:bwh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     A9C19_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 Ectoine_synth NTP_transf_3 EutQ AraC_binding Abi_2
Motif
Other DBs
NCBI-ProteinID: APH03555
UniProt: A0A1L3MMI1
Position
364209..365576
Genome map
AA seq 455 aa AA seqDB search
MRLVLLSGGSGKRLWPLSNDARSKQFLKVLENGSGQRVSMVQKVWGQLEELGLATSSVIA
TSKSQVEILKNQLGSNIRIVEEPERRDTFPAIALAASYLHTVEGASLDEVVAMLPVDPFV
DSSFFNKIKELENALDKTSANLALIGVSPTFPSSKYGYIVPSENNEKDYKKVSYFQEKPT
EQQAINLIEKNAYWNCGVFAFKLGYIIDIIKQKKCPIDYEELKNNYGKLPKISFDYEVVE
KTSDIIVLPYEGYWKDLGTWNTLTEEMSTSTLGKVFKSEDSSNTHVVNELEIPVSVLGIK
DAIIAASPDGILVSTKDASPRIKEVIGNLDQRPMYEERRWGWYKILDFAKQMNGNEVLTK
KIYLKKGKNLSYQHHTKRIEVWTIIQGEAELIQDGRITDVKSGDIIKIPAYSKHAIRAMS
DLEIIEVQSGEELVEEDIIRHNIEWEDILNSTINR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagattagtattattatcaggtggctcaggtaagcggctttggcctttatccaacgat
gctcggtcaaaacagtttttaaaagttctcgagaatggttcgggacagagagtatcaatg
gttcaaaaggtttggggacaattggaggaattaggcttagccacttcctctgttattgct
acaagtaagtctcaagttgagattttaaaaaatcagcttgggagtaatatacggattgtg
gaagagcccgaaagacgagacactttccctgctattgccttagctgcttcttatctacat
acagttgaaggggcaagcttagatgaagtcgtagcgatgcttcctgttgatccctttgtt
gattcgagcttttttaacaaaatcaaggaattagaaaatgcattagacaagacgagtgct
aatctagctctaataggtgttagtccaacctttccatcttctaaatatggatatattgtt
cctagtgaaaataacgaaaaagactacaaaaaagtaagttattttcaagagaaaccaaca
gaacaacaggccataaatttaattgagaaaaatgcgtattggaactgtggtgtatttgca
ttcaaattaggatatatcatagatattattaaacagaaaaaatgtcctattgattatgag
gaattgaaaaataattacggtaaattacctaaaattagttttgactatgaagttgtcgaa
aaaacctctgacataatagtattaccatatgaagggtactggaaggatttagggacttgg
aatacattaactgaagaaatgtctacaagtactctgggtaaagtgtttaagagtgaggat
tcttccaatacacatgttgtgaatgagctagaaatccctgttagcgttctagggattaaa
gatgccatcatagcagctagtcccgatggaattctagtctccacaaaagatgctagccca
agaattaaggaagtcattggaaacctagaccaacgtccaatgtatgaggagagaagatgg
ggctggtataagatcttggatttcgctaaacaaatgaatggtaacgaagttttaactaaa
aagatttacttgaaaaaagggaaaaatctaagttatcaacatcatacgaaaagaattgag
gtttggacaattatccaaggtgaggctgaacttatccaagatggaaggatcactgatgtc
aagagtggagatataataaaaattccggcctattcaaaacatgctattagagctatgtct
gatctggaaataattgaagttcaatcaggagaagagttagtagaggaagatattattaga
cataatattgaatgggaagatattttaaacagtactataaatagataa

DBGET integrated database retrieval system