KEGG   Bacillus weihaiensis: A9C19_02415Help
Entry
A9C19_02415       CDS       T04822                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00260  Glycine, serine and threonine metabolism
bwh01100  Metabolic pathways
bwh01110  Biosynthesis of secondary metabolites
bwh01120  Microbial metabolism in diverse environments
bwh01130  Biosynthesis of antibiotics
bwh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9C19_02415
Enzymes [BR:bwh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A9C19_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: APH03702
UniProt: A0A1L3MN21
Position
530331..531362
Genome map
AA seq 343 aa AA seqDB search
MYSFKNDYSEGAHPSILQALMETNLVQEDGYGGDQFTKSAIELIKKQLGSDKADVHLLAG
GTQTNLISISAFLRPHEAAIAASTGHIFTHETGAIEATGHKIISVETKAGKLTPADVEKV
LQDHPDEHMVKPRLVYISNSTEIGTIYKKQELTDLHHCCKKHHLLLFMDGARLGSALCSS
QNDLELKEIASLVDAFYIGGTKNGALLGEALVLCDDVLKEDFRYHMKQKGALLAKGRLLG
IQFQVLFQNQLYWELATHANQMADLLRRELQEAGYSFLADSPTNQIFPILSNELIEQLER
KYGFHIWEKVDDHNTAIRLVTSWATKEEEVLAFIEDIKRKSII
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttttaaaaatgattatagtgaaggtgcacatccgagtattttacaagcatta
atggaaacaaacctggtccaagaagatggctacggtggcgatcagtttaccaaatcagca
atagaattgatcaaaaaacagcttggtagtgataaggctgatgtccatttgcttgcaggt
ggaacgcaaacgaatctgatatcgatttcagcttttttacgacctcatgaagcagctatt
gcagcaagtacagggcatattttcactcatgagactggagcaattgaagcaacaggtcac
aaaattatttccgttgagacgaaagcggggaaactcactccagctgatgttgagaaggtg
ttgcaggatcacccagacgaacatatggtaaagccaaggctcgtttacatatctaattca
actgaaattgggacaatatacaagaagcaggaattaacagatctccatcactgttgtaaa
aaacatcatctccttttattcatggatggggcccgacttggttcagcgctttgctcttca
caaaacgatttagagctaaaagagattgcgagtctcgtcgatgctttttatattggaggg
acaaaaaatggtgcacttttaggagaagcgcttgtcctttgtgacgatgtgttgaaggag
gattttcgctaccatatgaaacaaaagggtgctttacttgcgaagggtagattacttggc
attcagtttcaggtgctttttcaaaatcaactgtactgggaattagctacacatgctaat
cagatggcggacttacttagaagggagttgcaggaggcaggctattcatttttagcagat
tcaccaaccaatcaaattttccccatcctgtcaaatgagttgattgaacagctagaaaga
aaatatggctttcatatatgggaaaaggtagatgatcataacacagctattcgtcttgtc
acttcttgggctacaaaggaagaggaagttttggcttttattgaggatataaaaagaaaa
tcgattatatag

DBGET integrated database retrieval system