KEGG   Bacillus weihaiensis: A9C19_04295Help
Entry
A9C19_04295       CDS       T04822                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00072  Synthesis and degradation of ketone bodies
bwh00280  Valine, leucine and isoleucine degradation
bwh00650  Butanoate metabolism
bwh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9C19_04295
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A9C19_04295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9C19_04295
Enzymes [BR:bwh01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     A9C19_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: APH04017
UniProt: A0A1L3MNT4
Position
921898..922563
Genome map
AA seq 221 aa AA seqDB search
MSKENVREKIARRAEQEIESGYYVNLGIGMPTLVANYIHETKLVVLQSENGLLGIGPYPS
EEDVDADLINAGKETVTTIPGSSFFSSAESFAMIRGGHIDIAILGGMEVSENGDLANWMI
PGKMIKGMGGAMDLVHGAKKIVVIMEHVSKNGQSKIVKQCSLPLTGKGVVDRIITDRAVM
DVTSEGLVLTEVLEGYTVEDVISSTEASLIVSEHVKLESSM
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaaatgttcgtgaaaagattgcacgtcgagctgagcaagaaattgaaagc
ggttactatgtaaaccttggaattgggatgcctactttggttgcgaactatattcacgaa
actaagcttgtcgttcttcaatcagagaatggtttattaggaatcggtccatatccatct
gaagaggatgttgatgctgatttaataaatgcagggaaagaaacagtcacgactatacca
gggtctagcttctttagcagtgctgagtcatttgccatgatacgtggtggtcatatcgac
attgccattctaggcggaatggaagtttcagagaatggtgatttagcaaattggatgata
ccaggaaagatgataaaaggcatgggcggggccatggatttagttcatggagcgaaaaaa
attgttgtcataatggagcatgtatcaaaaaatggacaatcgaaaatcgttaaacaatgc
agcttgccattaacgggaaagggtgtagtagatcgtatcattacagatcgagccgttatg
gatgtgacttctgaaggactagttttaactgaggtacttgaaggttatacagttgaagat
gttataagctcaactgaagctagtttaatcgtttctgaacatgtgaagctagaatcttct
atgtaa

DBGET integrated database retrieval system