KEGG   Bacillus weihaiensis: A9C19_10085Help
Entry
A9C19_10085       CDS       T04822                                 

Definition
(GenBank) cobalamin biosynthesis protein CbiE
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00860  Porphyrin and chlorophyll metabolism
bwh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A9C19_10085
Enzymes [BR:bwh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     A9C19_10085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_18 PCMT MTS Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: APH05069
UniProt: A0A1L3MRT5
Position
2132618..2133832
Genome map
AA seq 404 aa AA seqDB search
MNTKIKVIGIGDDGENSLLPLYQSWIKNSERLVGGERQLSFFPHYEGEKITIQGGLSTLL
TKLKEEPKDTIVLASGDPLFYGIGRYLSTKLEIETYPNISSIQLAFARLNESWNDAYVIS
LHGRKIQGFAQKIHGKKKVAILTDKTNTPATIAQYLLSFNMHEYTAFVAENLGGETEHYQ
SLTLEEMATREFSPLNVVILQQMKEVKQWTIGIDDEEFYQRKPEKGLLTKKEIRTLSLSE
LKLHEKSVVWDIGTCTGSVAIEACLVAKEGQVFAIEKNTYDLENCRQNMKKFRTDFTVVQ
GKAPEGLDVFPDPDSIFIGGTAGSMADIITLCCTRLKPNGRIVLNAVTIENLAQALELFK
SNSFETKITLAQVSRSKPILNLTRFDALNPIYIITAKHIKENES
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatactaaaataaaagtgattggaataggagacgacggtgaaaacagtctactccca
ctctatcaatcatggataaagaatagtgaacggttagtaggtggtgaaagacaattatca
tttttcccacattatgagggcgaaaaaattaccatacaaggtggactttccactctcctt
acgaagcttaaggaagaaccgaaagataccattgtcttagcttcaggtgatccattgttt
tacggaattggacggtatctatcaacaaaacttgaaattgaaacgtatcccaatattagt
tcgattcaactagcctttgctcgattaaacgaaagctggaatgatgcttacgttattagt
cttcacggtcgaaagatacaaggctttgctcaaaaaatccatgggaaaaagaaagtggcc
attttaactgacaaaacaaataccccagctacaattgctcagtaccttctatcatttaac
atgcatgagtatactgcatttgttgcagaaaatttaggtggggaaaccgaacactatcaa
tctcttacattagaagaaatggctactcgtgaattttcgccactaaatgttgtcattcta
caacaaatgaaagaagtcaaacaatggacaattgggattgatgatgaggagttttatcaa
cgaaaacctgaaaaaggattactcacaaaaaaagaaatacgcacgttaagcttgagtgag
ctgaagcttcatgaaaaaagtgtagtttgggatattggaacttgtacaggctctgttgcc
attgaagcgtgtttagtagcaaaggaaggccaagtatttgccattgaaaagaatacgtac
gatttagaaaattgccgccaaaacatgaaaaaattccgaacagattttacggttgttcaa
ggaaaagcacctgaaggcttagatgtatttccagacccagacagtatttttataggggga
accgctggtagcatggccgacatcataactctatgctgcacacgattaaagcctaatgga
cgcattgttttaaatgctgtaaccattgaaaatctagctcaggcacttgaactatttaaa
tccaatagctttgaaacaaagattacattagctcaagtttcaagaagcaaaccgatttta
aatctaactcgctttgatgcgttaaatccaatttatatcataacagcaaagcatataaag
gagaatgaatcatga

DBGET integrated database retrieval system