KEGG   Bacillus weihaiensis: A9C19_10110Help
Entry
A9C19_10110       CDS       T04822                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00860  Porphyrin and chlorophyll metabolism
bwh01100  Metabolic pathways
Module
bwh_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A9C19_10110
Enzymes [BR:bwh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     A9C19_10110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase SNO GATase_5 Dirigent
Motif
Other DBs
NCBI-ProteinID: APH05074
UniProt: A0A1L3MS39
Position
2137818..2139329
Genome map
AA seq 503 aa AA seqDB search
MPSSQPIMFQGTHSDAGKSVIVTAFCRIFSQDGYKTAPFKSQNMALNSYITVDGKEIGRA
QGVQAEAANIQATTDMNPILIKPNRENESQIVVHGKPFKNMEAGAYRRDFFDTGIQLIQQ
SLINLNKRYDRIVIEGAGSPAEVNLNDRELVNMRVARMANAPVVLIGDIEKGGVFASLVG
TLQLLEKEDHNRVIGVIINKFRGDLSLLQPGLSWFEEYTGKKVLGVIPHLPNLNIDAEDS
VILNQYTHKQNSEKEIDIAVIQYPKISNFTDLDPFTVEEDCHIRYVSSAKELKQPDLVIL
PGSKNTIEDLLFLKNSGLADKLESLRQKGNTFFFGICGGYQMLGSEVHDPLSIESPFVTS
KGLQFVPLQTTITKEKTTTLSQGIVIFQNNRFEVKGYEIHMGITKFEGNIKPFIKKTTEL
DGCMSYNEKIIGTYFHGIFHNDPFRESYINHIREFKGLAPIYRRPSYVDIREEAYDRLAD
HVRHHVDLEYIETKMKEYQQAAT
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcctagctctcaacctatcatgtttcaagggactcattctgatgctggaaaaagtgtt
attgttacagcattttgtcggattttctcacaggatgggtataaaacagccccattcaaa
tcacaaaacatggctctaaattcctatattacggtcgatggaaaggaaattggtcgtgca
cagggagtacaagccgaggcagcaaatatccaagctacaaccgatatgaatcccattctc
attaaaccaaatcgcgagaatgaatcacaaatcgtggtccatgggaagccttttaagaat
atggaggctggtgcataccggagagacttctttgacacagggattcagctcattcagcaa
tctctcataaacttaaataaaaggtatgatcgtattgtcatagaaggtgcaggcagtcct
gctgaagtaaatttaaatgaccgcgaactcgtgaacatgcgtgtggcaaggatggccaat
gccccagttgttttaattggtgacattgaaaaaggaggtgtttttgctagtttagttgga
acacttcagcttttagagaaggaagatcataaccgggttatcggcgtgattattaataag
tttagaggggacctttcccttttacagccaggtcttagctggtttgaagaatatacagga
aagaaagttctaggggtcattccacatctccctaacttaaatatagatgcagaggattca
gtgatattaaaccagtatactcataaacaaaatagtgaaaaagaaattgatattgccgta
attcaatatccaaaaatctcaaattttactgatctagatccgtttacagtagaagaagat
tgccatatacgctatgtttcatctgcaaaagagttaaaacagccagaccttgttatttta
cctggtagtaaaaatacgattgaggacctacttttcttaaagaatagtggacttgcagat
aagcttgaatccttacgtcagaagggaaacacctttttctttggtatatgtggcggatat
cagatgcttggctcagaggtacatgaccccttatctattgaatctccttttgttacttca
aaaggcttacaatttgtgccgcttcaaacaactatcacgaaggaaaaaacaacgacctta
tctcagggaatcgtcatcttccaaaataatagatttgaagtgaaaggctacgagattcat
atgggaatcacaaagtttgagggtaatataaaaccttttataaaaaaaacgacagaacta
gacgggtgtatgtcatataacgaaaaaatcattggcacttactttcatggtatttttcat
aatgatccatttcgcgaatcgtatataaatcatattcgcgagtttaaaggtttagcgccg
atctatcgccgcccttcctacgtagatatccgcgaggaagcgtatgatcgactcgcagat
catgttcgacatcatgtagaccttgaatatattgaaacaaaaatgaaggaatatcagcaa
gcagcaacataa

DBGET integrated database retrieval system