KEGG   Bacillus weihaiensis: A9C19_15235Help
Entry
A9C19_15235       CDS       T04822                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bwh  Bacillus weihaiensis
Pathway
bwh00071  Fatty acid degradation
bwh00072  Synthesis and degradation of ketone bodies
bwh00280  Valine, leucine and isoleucine degradation
bwh00310  Lysine degradation
bwh00362  Benzoate degradation
bwh00380  Tryptophan metabolism
bwh00620  Pyruvate metabolism
bwh00630  Glyoxylate and dicarboxylate metabolism
bwh00640  Propanoate metabolism
bwh00650  Butanoate metabolism
bwh00900  Terpenoid backbone biosynthesis
bwh01100  Metabolic pathways
bwh01110  Biosynthesis of secondary metabolites
bwh01120  Microbial metabolism in diverse environments
bwh01130  Biosynthesis of antibiotics
bwh01200  Carbon metabolism
bwh01212  Fatty acid metabolism
bwh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9C19_15235
   00630 Glyoxylate and dicarboxylate metabolism
    A9C19_15235
   00640 Propanoate metabolism
    A9C19_15235
   00650 Butanoate metabolism
    A9C19_15235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A9C19_15235
   00072 Synthesis and degradation of ketone bodies
    A9C19_15235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9C19_15235
   00310 Lysine degradation
    A9C19_15235
   00380 Tryptophan metabolism
    A9C19_15235
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9C19_15235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9C19_15235
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A9C19_15235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bwh04147]
    A9C19_15235
Enzymes [BR:bwh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A9C19_15235
Exosome [BR:bwh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9C19_15235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: APH05979
UniProt: A0A1L3MUH8
Position
complement(3208114..3209286)
Genome map
AA seq 390 aa AA seqDB search
MREVVITSAARTPIGSFGGAFKELLPTQLAVPVLDEVVRRSKLHKSEVNEVILGHCIQRT
DEPNTARTSALLADFPETTTGYTIQRQCASGLQAILSGAMQIQTGHSDIVVAGGVEVMSS
SPYLLKQHRWGSRLQHGQVTDSVWEILEDPIHHIMMGETAENVAEEYEVSREEQDELALA
SHQRALAAIEGGRFEEEIVPIEVKTRKGMITVSKDEGPRDVTFEKLSTLKPIFREGGSVT
AGNASSLNDGAAAVVLMSREEAEKRGLPILAKISHYSVAGVDPKVMGIGPVPAVNKGLHS
LGWSIEDLDLVEINEAFAAQYLAVEKQLGLNRDKVNVNGSGISLGHPIGCTGSRIVVSLL
HELKRQKAKKGLASLCVGGGIGVALFVERE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagtagtcattacatcagcagcaagaacacctatcggaagttttggaggcgct
ttcaaagagctgttgccaacacagcttgctgtaccagtattagatgaggttgtaaggaga
agtaagcttcataaaagcgaggtaaacgaagttattttagggcactgtattcagcgaaca
gacgaaccgaatacagcccgtacctctgctcttttagcggatttcccagaaacaactaca
gggtatacgatacaaaggcagtgtgcatctggcttgcaagcgattctttccggagctatg
caaattcagactggtcactccgatattgtggttgcaggtggagtagaagtgatgagctca
agtccatatttgctcaagcagcatagatggggatctcgacttcagcacggtcaagtaaca
gatagtgtgtgggaaatattagaggatcctattcaccatattatgatgggagaaactgct
gagaatgtggcagaagaatatgaagtgtcacgtgaggagcaggatgaattagcgttagcg
agtcatcagcgtgccttagctgccattgaaggtggtaggtttgaagaagagattgtcccg
attgaagtgaaaacgagaaaaggaatgataactgtttctaaagatgaaggtcctagagat
gttacttttgaaaaattatcaactctaaagccaatttttagagagggtggctcagttaca
gcaggaaatgcctcatcattaaacgacggtgctgccgcagttgtcttaatgtctagggaa
gaagcagaaaaacgaggtctgcctatccttgcgaaaatttctcattactctgttgctggt
gttgatcctaaggtaatgggaattggaccagtccctgctgttaataaaggcttacattca
ttgggatggtcaatcgaagatcttgatttagtcgaaattaacgaagcgtttgctgcacag
tatctagcggtcgaaaagcagttaggtttaaatcgagacaaggtaaatgtgaatggtagt
ggcattagtcttgggcatccaattggttgtaccggttcaagaatcgtagtaagtctttta
cacgaattaaagcgccaaaaagcgaaaaaaggcttagcttcattatgtgttggcggagga
atcggtgttgccttatttgtagaaagagaataa

DBGET integrated database retrieval system