KEGG   Bacillus weihaiensis: A9C19_19225Help
Entry
A9C19_19225       CDS       T04822                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bwh  Bacillus weihaiensis
Pathway
bwh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bwh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A9C19_19225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bwh03011]
    A9C19_19225
Ribosome [BR:bwh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A9C19_19225
  Bacteria
    A9C19_19225
  Archaea
    A9C19_19225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TINF2_N
Motif
Other DBs
NCBI-ProteinID: APH06660
UniProt: A0A1L3MWK2
Position
complement(4044977..4045321)
Genome map
AA seq 114 aa AA seqDB search
MQQSKAVARTVRIAPRKARLVLDLIRGKQVGEAVAILNHTPKAASPIIEKVLKSAVANAE
HNYEMDINSLVVSEAYANEGPTLKRFRPRAMGRASAINKRTSHITIILTEKKEG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatctaaagctgtcgcaagaacagtacgcattgctcctcgtaaagctcgttta
gttttagatcttattcgaggtaagcaagtcggcgaagcagtagcgattttaaatcatacg
ccaaaggctgcttcaccaatcattgaaaaagtattaaaatctgctgtagctaacgctgag
cataactatgaaatggacattaatagcttagttgtatctgaagcttatgctaacgaaggt
ccaactcttaaacgtttccgcccacgtgctatgggtcgtgcaagtgctattaacaagcgt
actagccacattacaatcatcttaacagaaaagaaggagggataa

DBGET integrated database retrieval system