KEGG   Bacillus mycoides WSBC 10204: bwei_0581Help
Entry
bwei_0581         CDS       T03453                                 

Gene name
pah
Definition
(GenBank) Phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00360  Phenylalanine metabolism
bww00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bww00790  Folate biosynthesis
bww01100  Metabolic pathways
bww01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    bwei_0581 (pah)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bwei_0581 (pah)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    bwei_0581 (pah)
Enzymes [BR:bww01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     bwei_0581 (pah)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIW83248
UniProt: A0A0A0WGH1
Position
complement(524141..525895)
Genome map
AA seq 584 aa AA seqDB search
MTKKTEIPSHLKPFVSTQHYDQYTPVNHAVWRYIMRQNHSFLKDVAHPSYVNGLQSSGIN
IDTIPKVEEMNDCLAPSGWGAVTIDGLIPGVAFFDFQGHGLLPIATDIRKVENIEYTPAP
DIVHEAAGHAPILLDSTYAKYVKRFGQIGAKAFSTKEEHDAFEAVRTLTIVKESPTSTPE
EVAVAENAVIEKQNLVSGLSEAEQISRLFWWTVEYGLIGNINDPKIYGAGLLSSVGESKQ
CLTNAVKKVPFSIEACTGTTYDVTKMQPQLFVCESFEELTEALEQFSTTMAFKTGGTEGL
EKAIRSENHATTELSSGLQITGTFTETIKNDTGEVIYTRTSSPTALAIHNKQLANHSTSV
HSDGFGTPIGLLDGDIALENCTEEQLQSLGITIGSSAEFTFASGIHVKGTVTDIVKNDKK
IALISFINCAVTHKDRLLFDPSWGAFDMAVGSQITSVFPGAADAAAFFPMNEEVQETPDP
LVLNKLERMYQTVRDIRNDSILHDTHTDQLIAIQEVLNKFYPKEWLLRLEILELLLEHNK
GHEASAALLQQLSTFTTEESVTRLINNGLALLQVKDVKNDATIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaacagaaattccatcacatttaaaaccattcgtatccacacagcattat
gatcaatacacaccggtgaatcacgctgtttggcgttacattatgagacaaaaccatagc
ttcttaaaagatgttgctcatccatcctatgtcaacggactacaatcatctggtattaat
atagatacaattccaaaagtagaagaaatgaatgactgtttagcaccaagcggctggggt
gccgtaacgattgacggacttattcccggcgtcgcattcttcgattttcaggggcatgga
ttactaccaatcgcaacagatattcgtaaagtagaaaatatcgagtatacacccgctcct
gatatcgttcatgaagctgcaggccacgcaccgattttgcttgattctacatatgcaaaa
tatgtgaaacgctttggacaaattggagcgaaagctttctccacaaaagaagaacatgat
gcttttgaagccgttcgtacattaacgatcgtaaaagaaagccctacttctacacctgaa
gaagttgcagttgctgaaaatgctgtaatcgaaaaacaaaacttagtttctggtttatca
gaagcagaacaaatttcacgtttattctggtggacagtggaatacggcttaatcggcaat
ataaatgatccgaaaatttacggtgctggtctcctttcctctgtcggtgaaagtaagcag
tgcttaacaaacgctgtaaagaaagtcccattctcaattgaagcttgcaccgggacaact
tatgatgtaacaaaaatgcaaccacagctatttgtttgtgaatcatttgaagaattgact
gaggcccttgagcagttctctacaacgatggcatttaaaacaggtggaacagaaggatta
gaaaaagcaatccgctccgaaaatcatgctacaactgagctaagtagtggattacaaatt
acgggtacatttacagagacaattaaaaatgatactggtgaagttatttacacacgaaca
agctcaccaactgcattagcaattcataataaacaactagcaaatcattctacatctgtg
cacagcgatggattcgggacaccaatcggattactagatggagatattgcattagaaaat
tgtacagaagaacaattacaatcattaggcattacaattggaagcagtgcagagtttact
tttgcaagtggcattcatgtaaaaggaacagtaacagacattgtaaagaatgataaaaaa
attgctcttatctcctttataaattgtgcagttactcataaagatcgcttattatttgat
ccttcatggggagcatttgatatggctgtcggctcacaaatcacttctgtattcccagga
gcggcagatgcggctgcatttttcccgatgaatgaagaagtacaagaaacgcctgatcca
cttgtactgaataagcttgaacgtatgtatcaaacagttcgagatatacgtaacgatagt
attttacacgatactcatactgatcaattaatagctattcaagaagtattaaataaattt
tatccgaaagaatggttgcttcgtcttgaaattttagaattgcttttagaacataacaaa
ggtcacgaagcatcagcagcattattacaacaactttctactttcacaactgaagaatct
gtaacacgtcttattaacaatggtcttgcgttactgcaggtaaaggatgtgaaaaatgat
gctacgattaactaa

DBGET integrated database retrieval system