KEGG   Bacillus mycoides WSBC 10204: bwei_1088Help
Entry
bwei_1088         CDS       T03453                                 

Gene name
coaBC
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00770  Pantothenate and CoA biosynthesis
bww01100  Metabolic pathways
Module
bww_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    bwei_1088 (coaBC)
Enzymes [BR:bww01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     bwei_1088 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     bwei_1088 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AIW83748
UniProt: A0A0A0WHT4
Position
972370..973575
Genome map
AA seq 401 aa AA seqDB search
MLKGKKILLCVTGGIAVFKAAALTSKLTQAGALVKVMMSESAMKFVTPLTFQALSRHDVY
TDTFDEKDSAVIAHIDLADWADVVLVAPATANCIGKLAGGIADDMITTTLLATTAPVWIA
PAMNVHMYENKIVQKNMMTLKTLGYTFIEPGEGFLACGYVAKGRLEEPEAIIGRLEEAFS
EQQPLQGKRILITAGPTREKIDPVRFMTNFSSGKMGYAIAEVAASLGADVILVSGPTALE
SPLHVTTIQVESAQDMLEAVLQHYQSVDVVIKTAAVADYRPKYVHDNKMKKKNGDAVIEL
ERTVDILKTLGEKKDRQLLIGFAAETTNIEEYATRKLREKNANMIVANDVKAQGAGFGTD
TNIVTMYRKDGEIIELPLLTKKEVAREILKQIEMMLEDDYV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagggaaaaagatacttctatgtgtaacaggaggcattgcagtttttaaggcg
gctgcgttaacaagtaaattgacacaagctggcgctcttgtaaaagtaatgatgagtgag
tcggcaatgaagtttgttacgcctcttacatttcaagcactttctcgccatgatgtatat
acggatacgtttgatgagaaagactcggctgttattgctcatattgatttagcggattgg
gcagatgttgtacttgttgcacctgctacagctaattgtattggaaagttagctggcggt
attgctgatgatatgattacaactactttgttagctactacagctccagtgtggattgca
cctgctatgaatgtgcatatgtatgaaaataaaattgttcaaaaaaacatgatgacgtta
aaaacattaggatatacatttattgagcctggggaaggttttttagcatgtggttatgta
gcaaaaggaagactggaagaacctgaagcaattattggacgattagaagaggctttctcg
gaacaacaaccattgcaaggaaaacgaatattaataacagctggaccgacacgtgaaaag
attgatccggttcgttttatgacgaatttttcttctggaaagatggggtatgcgatcgca
gaagttgcagcaagcttaggtgctgatgtcatacttgtgtcaggaccgacagcattagag
tcaccattacatgtcacaacaatacaagtagaatctgcacaagatatgttagaggcagtc
cttcagcattatcagagtgtggatgttgtcatcaaaacagcagccgttgcagattaccgt
ccgaaatatgttcatgataataaaatgaaaaagaaaaatggcgatgctgtaattgaatta
gaaagaacagtggatattttaaaaacgttaggtgagaagaaggaccgacagttacttatc
ggtttcgcagctgaaacgacaaacatagaggaatacgcaacgagaaaattacgtgagaaa
aatgcaaatatgattgttgcgaatgacgtgaaagcgcaaggagctgggtttggtacggat
acaaatattgtgacaatgtatagaaaagatggagaaatcattgagctgccacttttaacg
aagaaagaagtggctcgtgaaatattaaagcaaatagaaatgatgttagaagatgattat
gtatga

DBGET integrated database retrieval system