KEGG   Bacillus mycoides WSBC 10204: bwei_1148Help
Entry
bwei_1148         CDS       T03453                                 

Gene name
ribF
Definition
(GenBank) riboflavin biosynthesis protein RibF
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00740  Riboflavin metabolism
bww01100  Metabolic pathways
bww01110  Biosynthesis of secondary metabolites
Module
bww_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    bwei_1148 (ribF)
Enzymes [BR:bww01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     bwei_1148 (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     bwei_1148 (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID: AIW83808
UniProt: A0A0A0WHZ0
Position
1037062..1038033
Genome map
AA seq 323 aa AA seqDB search
MKLIHLTHPHEQNKIELPPTVMALGYFDGIHLGHQRVIRTAKKIADERGCKSAVMTFHPH
PSVVLGKKEAHVEYITPMRLKEEIIASLGIDILYVVKFDEPFAGLLPQQFVDEYIIGLNV
KHVVAGFDYSYGRLGKGKMETLPFHARGEFTQTVIEKVEYQEEKVSSTSLRKLIRNGEME
QIPSILGRAYTVEGTVVHGDKRGRQIGFPTANVGLSDEYLLPPVGVYAVRLKVHDEWHDG
VCNIGYKPTFKENERQLSIEVHLFEFNKDIYDQSVTVEWHMRIREEKKFNGIDELVAQIA
QDKKVAQEYFASVKNILAFSNEK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacttattcatttaactcatccacatgaacaaaataaaatagaattaccacctact
gtaatggcattaggatattttgatggcattcatttaggacatcaacgtgtgattcgaaca
gcgaaaaaaatagcggatgaaagaggatgtaaaagtgctgtcatgacgttccatccacac
ccatctgttgtattaggaaaaaaagaagcgcatgtggagtatattacaccgatgcgcctt
aaagaagaaatcatcgcaagtttaggaattgatatcttatatgtggtgaaattcgatgag
ccatttgctggattattaccacagcagtttgtcgatgagtatattattggtttaaatgta
aagcatgtagtagcaggctttgattattcatatggacgtttaggaaaagggaagatggag
actttaccatttcatgcaagaggggagtttacacagaccgtgatcgaaaaagttgaatat
caagaagaaaaagtaagttctacttcattacgaaagttaattcgaaacggtgaaatggaa
caaattccatctattttagggagagcttacacggtagaaggaacagttgtacacggtgat
aagcgtggacgtcaaattggtttcccaactgcaaatgtaggtttaagtgatgaatatttg
ttgccacctgtaggtgtatatgcggtaaggttgaaggttcatgatgaatggcatgatggt
gtatgtaatatcggatataaaccaactttcaaagagaatgagcgtcaattatctattgaa
gtgcatctatttgaatttaataaagacatatacgatcaaagtgttacagtggaatggcac
atgcgtataagagaagaaaaaaagtttaatggaattgatgagttagttgcgcaaatcgct
caagataaaaaggttgcccaagaatattttgcgagcgtaaagaatatacttgctttttca
aatgaaaagtag

DBGET integrated database retrieval system