KEGG   Bacillus mycoides WSBC 10204: bwei_1330Help
Entry
bwei_1330         CDS       T03453                                 

Gene name
fadA3
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00071  Fatty acid degradation
bww00072  Synthesis and degradation of ketone bodies
bww00280  Valine, leucine and isoleucine degradation
bww00310  Lysine degradation
bww00362  Benzoate degradation
bww00380  Tryptophan metabolism
bww00620  Pyruvate metabolism
bww00630  Glyoxylate and dicarboxylate metabolism
bww00640  Propanoate metabolism
bww00650  Butanoate metabolism
bww00900  Terpenoid backbone biosynthesis
bww01100  Metabolic pathways
bww01110  Biosynthesis of secondary metabolites
bww01120  Microbial metabolism in diverse environments
bww01130  Biosynthesis of antibiotics
bww01200  Carbon metabolism
bww01212  Fatty acid metabolism
bww02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bwei_1330 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    bwei_1330 (fadA3)
   00640 Propanoate metabolism
    bwei_1330 (fadA3)
   00650 Butanoate metabolism
    bwei_1330 (fadA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    bwei_1330 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    bwei_1330 (fadA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bwei_1330 (fadA3)
   00310 Lysine degradation
    bwei_1330 (fadA3)
   00380 Tryptophan metabolism
    bwei_1330 (fadA3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bwei_1330 (fadA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bwei_1330 (fadA3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bwei_1330 (fadA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bww04147]
    bwei_1330 (fadA3)
Enzymes [BR:bww01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bwei_1330 (fadA3)
Exosome [BR:bww04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bwei_1330 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIW83986
UniProt: A0A0A0WHT6
Position
1224334..1225431
Genome map
AA seq 365 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGIEREIDDVILGNVVGPGGNV
ARLSALEAGLGYHIPGVTIDRQCGAGLEAIRTACHFIQGGAGNCYIAGGVESTSTSPFQN
RARFSPETIGDPDMGLAAEYVAEQYNITKEMQDEYACLSYKRTLQALEKGYIQEEILPHY
FNGLLDESIKREMNYERMIKRTKPVFLQNGTVTAGNSCGVNDGACAVLVMEEGQARKLGY
KPVLRFVHSAVVGVDPNLPGTGPIFVVQKLLREMNLVIEDIDCIEMNEAFAAKVVACAQT
LQIPYEKLNVNGGAIALGHPYGGSGAMLVTRLFYQAKREYMKYGIATLGIGGGIGLALLF
EKVEN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatagggcggttattgtagaagcgaaaagaacacctattggtaaaaaaaacgggatg
ttgaaagattatgaagttcagcaattagcagcaccacttcttacgtttttaagtaaagga
attgagagagaaatagacgatgttatattagggaatgttgttggaccgggaggtaatgtt
gcaagattatctgctttagaagctgggcttggttatcatatacctggtgtaacgattgat
cggcaatgcggcgctggattggaagcaattcgcaccgcatgtcatttcattcaaggcggc
gcaggtaattgttatattgcaggaggagtagagagtacaagtacatcaccttttcaaaat
agagcgcgattttcaccagaaacaattggtgatccagatatgggattagcggctgagtat
gttgcagagcaatataacataacaaaagagatgcaagatgaatatgcttgtcttagctat
aaaagaacgctgcaagcattagaaaaaggatatatacaagaagagatattacctcattat
tttaatggattattagatgaatctataaagcgagaaatgaattatgaaagaatgattaag
agaacgaaacctgtatttttacaaaatggaacggtaacagcagggaattcgtgtggtgta
aatgacggggcatgtgctgttcttgtaatggaagaggggcaagcacggaaattagggtac
aagccagttcttcgtttcgttcatagtgctgtagttggagttgacccaaatcttccagga
actggtccgatatttgtcgtacaaaaactacttagagaaatgaatttagtaatagaagat
attgattgtattgagatgaatgaagcgttcgccgctaaagttgttgcatgtgcgcaaacg
ttacaaattccgtatgaaaagttaaatgtaaatggtggtgcaatagcacttggtcatccg
tacggtgggtctggagctatgcttgtaacgcgcttgttttatcaggctaaaagagagtat
atgaaatatggaattgctacattaggaattgggggagggatagggcttgctctattattt
gagaaagtagaaaactag

DBGET integrated database retrieval system