KEGG   Bacillus mycoides WSBC 10204: bwei_1392Help
Entry
bwei_1392         CDS       T03453                                 

Gene name
yueD
Definition
(GenBank) benzil reductase
  KO
K16216  benzil reductase ((S)-benzoin forming) [EC:1.1.1.320]
Organism
bww  Bacillus mycoides WSBC 10204
Brite
KEGG Orthology (KO) [BR:bww00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    bwei_1392 (yueD)
Enzymes [BR:bww01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.320  benzil reductase [(S)-benzoin forming]
     bwei_1392 (yueD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd Polysacc_synt_2 THF_DHG_CYH_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AIW84047
UniProt: A0A0A0WPA8
Position
complement(1287099..1287848)
Genome map
AA seq 249 aa AA seqDB search
MRYVIVTGTSQGLGEAIAVQLLEENTTVISISRRENKQLAKLAEQNDSNCIFHSIDLQDV
HNLETHFNEVFSSIQKDNVSSIHLINNAGTLAPMKPIEKSESEQFITNVHINLIAPMILT
STFMKHTKDWKVEKRIINISSGAGKNPYFGWGAYCTTKAGVNMFTQCVATEEVEKEYPVK
TVAFAPGVVDTNMQAQIRETNKEDFINLDRFTALKEEGKLLSPEYVAKAIRNLLETENFP
QGEVIRIDE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgttatcgtaacaggaacttcacaaggtttaggtgaggcaatcgccgtgcaa
ttgttagaagaaaatacaaccgttatctctatttctaggagagaaaataaacagcttgca
aaactcgcagagcaaaacgacagcaattgtattttccattccatagatcttcaagatgta
cataatttagaaactcattttaacgaagtcttttcatctattcaaaaagacaatgtctca
tcgattcatttaattaataatgcaggaacacttgcaccaatgaaacctattgaaaagtca
gaaagtgaacaattcattacgaacgttcacattaatttaatcgcaccaatgatccttact
tccactttcatgaaacatacgaaagactggaaagtagaaaaacgcattataaatatttca
tctggagcaggaaaaaatccttatttcggatggggagcttattgtacaacgaaagccggt
gtaaatatgtttacacagtgcgtagctactgaagaagtggagaaagaatatcctgtaaaa
actgtcgctttcgcacccggtgttgttgatacaaatatgcaagcacaaattcgtgaaaca
aataaggaagactttattaacttagatcgattcaccgcattaaaagaagaaggaaagcta
ctgtcacctgaatatgttgcgaaagctattcgtaacttactagaaactgagaatttcccg
cagggtgaagtaattcgaattgatgaataa

DBGET integrated database retrieval system