KEGG   Bacillus mycoides WSBC 10204: bwei_3627Help
Entry
bwei_3627         CDS       T03453                                 

Gene name
dltA1
Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase, subunit 1
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00473  D-Alanine metabolism
bww01100  Metabolic pathways
bww01503  Cationic antimicrobial peptide (CAMP) resistance
bww02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bwei_3627 (dltA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bwei_3627 (dltA1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    bwei_3627 (dltA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bww01504]
    bwei_3627 (dltA1)
Enzymes [BR:bww01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     bwei_3627 (dltA1)
Antimicrobial resistance genes [BR:bww01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    bwei_3627 (dltA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AIW86240
UniProt: A0A0A0WSZ5
Position
3439888..3441402
Genome map
AA seq 504 aa AA seqDB search
MKLLEQIEKWAVETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHM
QPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSGTEVTVTDLPVRIVSE
DNLKDIFFTHKGNIPNPEHAVKGDENFYIIYTSGSTGNPKGVQITYNCLVSFTKWAVEDF
NLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWT
STPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKAVIMNTYGPTEAT
VAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYL
GSPELTEKVFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRA
CSYVEGAVVVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFM
YHSSIPMTPNGKVDRKKLLSEVTA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagttattagaacaaattgaaaagtgggctgtagaaacgcctgatcaaaccgctttt
gtttggcgagatgcgaaaattacgtacaaacaattaaaggaagattctgatgcgttagca
cattggatttcttctgagtatccagatgatcgttcaccaattatggtttatggccatatg
caacctgaaatgattattaactttttaggttgtgtaaaagctggacatgcttacattcct
gtagatttatctatcccagctgatcgcgtacaacgtatcgctgaaaattctggtgcgaaa
ttacttttatcaggaactgaagtaactgtaactgatttaccagttcgcattgtaagtgaa
gacaacttaaaagatattttctttactcataaagggaacattccaaatcctgaacatgcg
gtaaaaggtgatgagaacttctacattatttacacatcaggaagtacaggtaatccgaaa
ggggttcagattacttataactgtcttgttagctttacaaaatgggctgtagaagatttc
aacttacaaacagggcaagtattcttaaaccaagcacctttctcattcgatttatctgta
atggatatttacccatcgttagtaacaggtggtacactttgggcaatcgataaagatatg
attgcacgtccaaaagacttgtttgcttctttagagcaatcggatatacaagtatggact
tcgacaccatctttcgcagaaatgtgtttaatggaagcctctttctctgaaagtatgcta
ccaaacatgaaaacattcttattctgcggtgaagtgttaccaaatgaagtagctagaaaa
ttaattgagcgtttcccgaaagcagtaattatgaatacgtacggtccaacagaagctact
gttgctgtaacaggcattcacgttacagaagaagtgcttgatcaatacaaatcacttcca
gttggctactgtaaatcagactgtcgccttcttattatgaaagaagatggtacaattgca
cctgacggtgaaaaaggtgaaatcgtaattgtcggtccaagcgtaagcgttggctattta
ggaagccctgaattaacagaaaaagtatttaccatgattgatggtgagcgtgcctataaa
acaggtgatgctggctatgtagaaaatggtcttctattctataatggtcgtcttgatttc
caaattaagcttcatggttatcgaatggaattagaagaaatcgaacatcatcttcgcgcg
tgttcttacgtagaaggtgcagttgttgttccaattaaaaaaggtgaaaaatatgattac
ttattagcggttgttgttcctggagagcattcgtttgaaaaagaattcaaattaacatct
gcaatcaaaaaagaactcaatgagcgattaccaaattacatgattccacgtaaattcatg
tatcactcttctattccaatgacaccaaatggaaaggtagatcgcaaaaaattattgagt
gaggttacagcatga

DBGET integrated database retrieval system