KEGG   Bacillus mycoides WSBC 10204: bwei_4923Help
Entry
bwei_4923         CDS       T03453                                 

Gene name
adhB
Definition
(GenBank) Zinc-containing alcohol dehydrogenase, long-chain
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    bwei_4923 (adhB)
Enzymes [BR:bww01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     bwei_4923 (adhB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     bwei_4923 (adhB)
    1.1.1.-  
     bwei_4923 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N Gp_dh_N OxoDH_E1alpha_N
Motif
Other DBs
NCBI-ProteinID: AIW87508
UniProt: A0A084IZ59
Position
complement(4661013..4662065)
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVRPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVIGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactactttggcataatcaacgtgatgtacgagtagaagaagtaccagaacca
actgtaagaccaggagcagttaagattaaagttaaatggtgtggtatctgcggaacagac
ttgcatgaatatttagcaggacctatttttattccaacagaagagcacccattaacacac
gtaaaagcaccggttattttaggtcatgagtttagtggtgaggtagttgaaatcggtgaa
ggcgttacttctcataaagtgggagatcgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacacggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggtccac
catattcctgatgaaatgacgtatgaacaaggtgcacttgtagaaccagcagcagtagca
gttcatgcagtacgtcaaagtaaattaaaagagggagaagctgtagcggtatttggttgt
ggtccgattggacttcttgtaatccaagcagcaaaagcagcaggagcaactcctgttatc
gcagtggaactttctaaagaacgtcaagagctagctaaattagcaggtgctgattacgta
ttaaatccagcaactcaagatgtactagcagaaattcgtaacctaacaaatggtttaggt
gtaaatgtgagctttgaagtaacaggtgttgaggtagtacttcgtcaagcgattgaaagt
acaagctttgaaggccaaactgtaattgttagtgtatgggaaaaagatgcgacaattact
ccaaacaaccttgtattaaaagaaaaagaagttatcggtattcttggataccgtcatatc
ttcccagctgttattaaattaattagctctggccaaattcaagcagagaaattaattacg
aaaaaaatcacagtggatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system