KEGG   Bacillus mycoides WSBC 10204: bwei_5425Help
Entry
bwei_5425         CDS       T03453                                 

Gene name
manC
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00051  Fructose and mannose metabolism
bww00520  Amino sugar and nucleotide sugar metabolism
bww01100  Metabolic pathways
bww01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    bwei_5425 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    bwei_5425 (manC)
Enzymes [BR:bww01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     bwei_5425 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 AraC_binding Cupin_1 EutQ Ectoine_synth Cupin_3
Motif
Other DBs
NCBI-ProteinID: AIW87958
UniProt: A0A0A0WUR8
Position
complement(5196508..5197893)
Genome map
AA seq 461 aa AA seqDB search
MKLILLSGGSGKRLWPLSNDTRSKQFLKVLESEEGTRQSMVQRVWGQLESVGLNESAVIA
TSKTQTEMIHNQLGMNVPLIVEPERRDTFPAIALASAFLFSEQHTNLDETVIVLPVDPYV
EDSFFERVKDLEAALQNSNADLALMGVEPTYPSSKYGYIVPTEEATTCEYFNVSRFTEKP
SEEKAVTLIEQKALWNCGVFAFKLRYLINILEEKNLPILYHDLSERYSELPKISFDYEVV
EKANHIVALPYSGYWKDLGTWNTLTEEMATTQIGKGVISEDSQNTHVVNELEVPVTVVGL
SDIVVAASPDGILVSDKASSPKIKDLIGSFNQPPMYEERIWGWSKVLDYAKYENEEMVTK
RICIEENKDSTYHYHNLRNEVWTIIRGEGELILEDHIRRVKAGDIVHIPAGKKHAIRALS
ELEFIEVQTGKEVIDTDFVRLYTKWDDILKHYYQSKAQVIM
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttaattctattatcaggtggatccggaaaacgcttatggccattatcaaacgat
actcgttctaagcaatttttaaaagtattagaaagtgaagaaggtacacgtcaatcgatg
gtgcaacgtgtatggggacaattagagtcagttggtttaaatgaatcagcagttattgct
acgtcaaaaacacaaacagagatgattcataatcagttaggaatgaacgttccattaatt
gttgaaccggagcgtagagatacattcccggcaattgctcttgctagtgcatttctattt
tctgaacaacatacaaatttagatgaaacggttattgtattgccagtagatccttacgtc
gaagatagcttttttgaaagagtaaaagatttagaggcagcgttacaaaactcaaatgct
gatttagctcttatgggggttgagccaacatatccatcttctaagtatggttatattgta
ccaacagaagaggctactacatgtgaatattttaatgtatcacgttttacagaaaaaccg
agtgaggaaaaagcagtaacactaattgaacaaaaggcattatggaattgtggtgtattt
gcttttaaattacgttatttaattaatattttagaagaaaaaaatcttccgattttatat
catgatctctcagagaggtatagtgaactaccaaagattagctttgattatgaagttgtt
gaaaaggctaatcacattgttgcattaccgtatagtgggtattggaaagatttaggtaca
tggaatacattgacggaagaaatggctacaactcaaattgggaagggtgtaattagtgag
gactcccaaaatacacatgtagtaaatgaattagaagttccggtaacagttgtcggtctt
tctgatattgttgttgcggctagcccagatggtattttagtttcagataaagcttcaagt
ccaaagattaaagacttaattggttcatttaatcaaccaccaatgtatgaagagcgcatt
tggggatggtccaaggtgcttgattatgctaagtatgaaaatgaggaaatggtaacgaaa
agaatttgtatagaggaaaacaaagattctacgtatcattatcataatttacgaaatgaa
gtatggacaattattcgtggtgaaggagaactgattttagaagatcatattcgtcgcgta
aaagcaggagatattgtacatattccagctggtaaaaagcatgctatccgagcattgagt
gaactagaatttattgaagtacaaacaggaaaagaagtaatagacaccgattttgttcgt
ttgtatacaaagtgggacgatattttaaagcattattatcaatcaaaagcacaagtaatt
atgtaa

DBGET integrated database retrieval system