KEGG   Paraburkholderia xenovorans LB400: DR64_1093Help
Entry
DR64_1093         CDS       T03290                                 

Definition
(GenBank) ABC transporter family protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DR64_1093
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxb02000]
    DR64_1093
Enzymes [BR:bxb01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     DR64_1093
Transporters [BR:bxb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DR64_1093
   Histidine transporter
    DR64_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_16 Zeta_toxin APS_kinase AAA_33 RsgA_GTPase G-alpha PRK AAA_22 AAA_23 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AIP31799
UniProt: Q142Z7
Position
1:1162279..1163058
Genome map
AA seq 259 aa AA seqDB search
MNTKKQKLFVDELHKQYGDNEVLKGVSLKANAGDVISVIGSSGSGKSTMLRCINFLEQPN
SGRIFVDGEEVRTQIGKNGALRVSDPKQLQRVRTRLSMVFQHFNLWAHMNVLENIIEAPV
NVLGLKRKEAEERAREYLEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMNPDVMLFDE
PTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMAFSRNVSNHVMFLHQGRVEEEGHPDE
VFRNTKSERLKQFLSGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaagaagcagaagctctttgtcgacgagcttcacaaacagtacggcgacaac
gaagttctcaaaggcgtgtcgctcaaagccaacgccggagacgtgatcagcgtgatcggc
tcgtccggttcgggcaagagcacgatgcttcgctgcatcaactttctcgaacagccgaac
tccgggcgcatcttcgtcgacggtgaagaagtgcgcacgcagatcggcaagaacggcgcg
ctgcgcgtgtccgacccgaagcagttgcagcgcgtgcgcacccggctttcgatggtgttt
cagcacttcaacctgtgggcgcatatgaacgtgctcgagaacatcatcgaggcgcccgtc
aacgtgctgggtctgaagcgcaaggaagccgaagagcgcgcgcgtgaatatctggaaaag
gtcgggctcgcgccgcgcctcgaaaagcagtatccgtcgcatctgtcgggcggccagcag
cagcgcgtggcgattgcccgcgcgctggccatgaacccggacgtgatgctgttcgacgag
ccgacttccgcgctcgacccggaactggtcggcgaagtgctgaaggtcatgcagaagctc
gccgaagaaggccgcacgatgatagtcgtcacgcatgaaatggcattctcgcgcaacgtg
tcgaaccacgtgatgtttctgcatcaaggccgggtggaagaagaaggccatcccgacgaa
gtattcaggaacacgaagagcgaacggctcaagcaattcctctccggcagcctcaaatag

DBGET integrated database retrieval system