KEGG   Paraburkholderia xenovorans LB400: DR64_1978Help
Entry
DR64_1978         CDS       T03290                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00051  Fructose and mannose metabolism
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DR64_1978
Enzymes [BR:bxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     DR64_1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIP30416
Position
1:2163101..2163832
Genome map
AA seq 243 aa AA seqDB search
MQTALPELVWATREKLALTCRILFEQGHDSGLAGQITARTDEPDTYYTQRFGLGFDEITA
SNLVHVNQDLKLVSGEGMPNPANRFHTWIYRARPDVNCIIHTHPLHVAALSMLETPLVVS
HMDLCPLHDDCAFLEQWPGVPVGNEEGEIISAALGGKRAILLSHHGQLVTGSTIEEACTL
ALLIERAAQMQLLAMAAGDVKPIPAELGREAHDWISTPKRNQATFAYFARRALRSPMHRD
CLA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgccttgcccgaactcgtatgggcgactcgcgagaagctcgcactgacctgc
cggattctgttcgagcagggccacgattccgggctcgccgggcagatcaccgcccgcacc
gacgagccggacacttactacacacagcgtttcggcctgggcttcgacgagatcacggcg
tcgaacctcgtccacgtgaatcaggatttgaagctcgtctccggcgagggcatgccgaat
ccggcgaaccgctttcacacgtggatctatcgggcgcgaccggatgtgaactgcatcatc
cacacgcacccgctgcatgtcgccgcgctgtcgatgctggaaacgccgctcgtcgtctcg
cacatggatctgtgcccgctccatgacgattgcgcgtttctcgaacaatggccaggcgtt
ccggtcggcaacgaagaaggcgaaatcatctcggcggcgctcggcgggaagcgcgcgatc
ctgctttcgcatcatggccaactggtcaccggcagcacgatcgaagaggcctgcacgctc
gcgctcctgattgagcgcgccgcgcaaatgcaattgctcgcaatggcggccggcgacgtg
aagcccattcccgccgaactcggccgggaagcacacgactggatttccacacccaaacgc
aatcaggcgacgttcgcctacttcgcccgccgcgcgctgcgcagtccgatgcaccgcgat
tgtctcgcctga

DBGET integrated database retrieval system