KEGG   Paraburkholderia xenovorans LB400: DR64_2228Help
Entry
DR64_2228         CDS       T03290                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00250  Alanine, aspartate and glutamate metabolism
bxb00330  Arginine and proline metabolism
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DR64_2228
   00330 Arginine and proline metabolism
    DR64_2228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bxb03000]
    DR64_2228
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     DR64_2228
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     DR64_2228
Transcription factors [BR:bxb03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    DR64_2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AIP33216
UniProt: Q13SR1
Position
1:2448653..2452582
Genome map
AA seq 1309 aa AA seqDB search
MASTTLGVKVDDLLRSRLKDAATRLERTPHWLIKQAIFAYLEKIEHGQLPPELSGVAGSA
DLTEGAAVEHEEDGGSHPFLDFAQNVQPQSVLRAAITAAYRRPEPECLPFLLGQARLPAN
LAGDVQTMAGKLVETLRTKSKGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWKSHMGQAPSMFVNAATWGLMITGKLVTTNSETSLSSALTRLIGKGGEPL
IRKGVDMAMRLMGEQFVTGENISEALANSRKYEARGFRYSYDMLGEAATTEADAQRYYAS
YEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMSELLPRVRSLAILARRY
DIGLNIDAEEADRLEISLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIEYLIDLARR
SRHRIMVRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLSAPDAVYPQ
FATHNAHTLSAIYHLAGNNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTH
ETLLAYLVRRLLENGANTSFVNRIADETVAIKDLIADPVDEASKIVPLGAPHAKIPLPRN
LYGSERLNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLEDNEIAVGLARDVRNPADH
RDLVGTVVETTPEHVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLVV
REAGKSLANAVAEIREAIDFLRYYSTQIREEFSNDTHRPLGPVVCISPWNFPLAIFMGQV
AAALAAGNTVLAKPAEQTPLIAAQAVRILREAGVPAGAVQLLPGNGETVGAALVADPRTR
AVMFTGSTEVARLINKTLSSRLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVLQSS
FDSAGQRCSALRVLCLQDDVADRTLEMLTGAMRELAVGNPDRLSVDVGPVIDLDAKRGID
AHVAAMREKGRKVEQLPMPDGCAQGTFVPPTLIELDSIDELKREVFGPVLHVVRYRRSQL
DKLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLS
GTGPKAGGALYLQRLLATRPAGLPKSLARALVVDVPRAAENGDNPSAVLTAYRDWLITER
EPQLAARCDGYLSHVPAGATAVLSGPTGERNTYTLGARGTVLCIASTASGARVQFAAALA
TGNRALFEGAAGEQLVSQLPASLKSHASVKKSADTPFDAVLFEGDSDELLALVKEVAKRP
GPIVSVQGVAARALESGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggctagcaccacccttggcgtcaaggtcgacgacctcttgcgttcccggctgaaagat
gccgctacccgtctcgaacgcactccgcactggctcatcaagcaggccatcttcgcgtac
ctcgaaaagatcgagcacggtcaattgccgcccgagctgtcgggtgtggcgggctcggcc
gatctgaccgagggcgccgcggtcgaacacgaggaagacggtgggtcgcacccgttcctc
gatttcgcgcaaaacgtgcaaccgcaatcggtgctgcgcgccgcgatcacggccgcttac
cgtcgtcctgagccggagtgtttgccgttcctgctcggtcaggcgcgtttgccggccaac
ctcgcgggcgacgtgcagacgatggccggcaagctcgtcgaaacgctgcgcacgaagagc
aagggcggtggcgtcgaaggtctgatccacgagttctcgctgtcgagccaggaaggcgtg
gcgctgatgtgtctcgccgaagcgctgctgcgcattcccgaccgcgccacgcgcgacgcg
ctgatccgcgacaagatcagcaagggcgactggaaatcgcacatgggccaggcgccgtcg
atgttcgtcaacgccgcgacctggggcttgatgatcaccggcaagctggtgacgaccaac
agcgagacgagcctctcgtcggcgctcacgcgtctgatcggcaagggcggcgagccgctg
atccgcaagggcgtggatatggcaatgcgcctgatgggcgagcagttcgtcacgggtgag
aacatctccgaggcgctcgccaacagccgcaagtacgaagcccgcggcttccgctactcg
tacgacatgctcggcgaagcggccaccaccgaagccgacgcgcagcgctactacgcgtcg
tacgaacaggcgatccacgcgatcggcaaggctgccggcggccgtggcatctacgaaggc
ccgggcatttcgatcaagctctccgcgctgcacgcacgctactcgcgttcgcagcaggaa
cgcaccatgagcgaactgctgccgcgcgtgcgctcgctggcaatcctcgcgcgccgctac
gacatcggcctgaacatcgacgcggaagaagccgaccgcctcgaaatctcgctcgatctg
ctcgaagcgctgtgcttcgatccggagctggccggctggaacggcatcggcttcgtggtg
caggcgtatcagaagcgctgcccgttcgtgatcgaatacctgatcgatctggcgcgccgc
agccgtcaccgcatcatggtgcgcctcgtgaagggcgcgtactgggacaccgaaatcaag
cgcgcgcaagtggacggcctcgaaggctatccggtctacacgcgcaagatctacacagac
gtgtcgtatctcgcctgcgcgaagaaactgctcagcgcgcccgacgcggtctacccgcaa
ttcgccacgcacaacgcgcacacgctgtcggcgatctatcacctcgcgggcaacaactat
taccccggccagtacgagttccagtgcctgcacggcatgggcgaaccgctgtacgaagaa
gtcaccggccgcgacaagctgaaccgtccgtgccgggtgtacgcgccggtcggcacgcat
gaaacgctgcttgcctatctcgtgcgccgtctgctggaaaacggcgcgaacacgtcgttc
gtgaatcgtattgccgatgaaaccgtcgcgatcaaggacctgatcgccgatccggtcgat
gaagcctcgaagatcgtcccgctcggcgcgccgcacgcgaagattccgctgccgcgcaat
ctgtacggttcggaacgcctcaactcgatgggtctcgacctgtcgaacgagcatcgcctg
gcgtcgctgtcgtcggcgttgctggcgagcgcgcatcatccgtggcgcgccgcgccgatg
ctcgaagacaacgagatcgccgtgggcctcgcgcgcgacgtgcgcaatccggccgatcat
cgcgacctcgtcggcacggtcgtggaaacgacgccggagcacgtgagcgccgctttggcg
cacgcggtggccgccgcgccgatctggcaagccacgccggtcgatgcgcgcgccgattgc
ctcgcgcgtgccgccgatctgctcgaagcgcagatgcatacgctgatgggcctcgtggtg
cgtgaagccggcaagtcgctggccaacgccgtcgcggaaattcgcgaagcgatcgacttc
ctgcgttactactccacgcagattcgcgaggagttctccaacgacacgcatcgtccgctc
ggcccggtggtctgtatcagcccgtggaatttcccgctggcgattttcatgggccaggtg
gccgcggcgctcgccgccggcaacaccgtgctcgcgaagccggccgaacagacgccgctg
atcgccgcgcaagccgtgcgcattctacgcgaagccggcgtgccggcgggcgcggtgcaa
ctgctgccgggcaacggtgaaacggtcggcgccgcattggtggccgatccgcgcacccgc
gcggtgatgttcaccggctcgaccgaagtcgcacgcctcatcaacaagacgctgtcgagc
cgactcgatccggatggcaagccgattccgctgatcgccgaaacgggcggccagaacgcg
atgatcgtcgactcgtcggcgcttgccgaacaggtggtggcggacgtgctgcaatcgtcg
ttcgactccgccggtcaacggtgttccgcgctgcgcgttctttgtctgcaggacgatgtc
gcggaccgcacgctggaaatgctgaccggcgcgatgcgcgaactggccgtgggcaatccg
gaccgtctgtcggtcgacgtcggcccggtgatcgacctcgacgcgaagcgcggtatcgac
gcgcacgtcgcggcgatgcgcgagaagggccgcaaggtcgagcagctgccgatgccggac
ggttgcgcgcaaggcaccttcgtgccgccgacgttgatcgaactcgacagcatcgacgaa
ctgaagcgtgaagtgttcggcccggtgctgcacgtggtgcgctaccgccgcagccagctg
gacaaactgctggagcagatccgcgcgaccggctatggcctgacgctcggcatccatacg
cgtatcgacgaaacgatcgcgcatgtgatcagccgcgcgcacgtgggcaacatctacgtg
aaccggaacgtgatcggcgctgtggtcggcgtgcagccgttcggtggcgaaggtttgtcg
ggcacgggtccgaaagcgggcggcgcgctctatctgcagcggctcctcgccacgcgtccg
gccggtttgccgaagtcgcttgcgcgggctttggtcgtggatgttccgcgcgcggccgaa
aacggcgacaatccgtccgctgtattgacggcttaccgcgactggctgattaccgaacgc
gagccgcaactggccgcgcgctgcgacggctatctgtcgcatgtgccggcgggcgccacg
gcggtattgtcgggaccgaccggcgagcgcaacacgtacacgctgggcgcgcgcggcacg
gtgctgtgtatcgcgtcgacggcgagcggtgcgcgcgtgcagtttgccgcggcgctggct
acgggaaatcgcgcgttgttcgaaggcgcggctggggaacaattggtgtcgcagttgccc
gcctcgctgaagtcgcacgcaagcgtgaagaagagtgccgatacgccgttcgacgccgtg
ctgttcgaaggcgatagcgacgaactgctggcgctggtgaaggaagtcgcgaagcgtcca
ggcccgatcgtgtcggtacagggcgtcgcggcacgcgcgctggaaagcggcgacgaggac
tacgcgctcgagcgtctgttgacggaacgctcggtcagcgtcaatacggcagctgcaggc
ggtaatgcgaatttgatgacgatcggttga

DBGET integrated database retrieval system