KEGG   Paraburkholderia xenovorans LB400: DR64_2489Help
Entry
DR64_2489         CDS       T03290                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DR64_2489 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bxb03011]
    DR64_2489 (rplV)
Ribosome [BR:bxb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DR64_2489 (rplV)
  Bacteria
    DR64_2489 (rplV)
  Archaea
    DR64_2489 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIP33065
UniProt: Q13TH5
Position
1:2731867..2732196
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKITSIYIDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaaaacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggctgcgggaatcgtgaaaaaggtcgtgctgtcggcgatcgcgaatgcggagcat
aacgaaggcgccgatatcgatgagctcaagatcacgagcatctacatcgacaaggctgcg
tcgctcaagcgttttaccgcgcgcgctaaaggccgcggtaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system