KEGG   Paraburkholderia xenovorans LB400: DR64_3304Help
Entry
DR64_3304         CDS       T03290                                 

Gene name
amnB
Definition
(GenBank) 2-aminophenol 1,6-dioxygenase beta subunit
  KO
K15059  2-aminophenol/2-amino-5-chlorophenol 1,6-dioxygenase subunit beta [EC:1.13.11.74 1.13.11.76]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00627  Aminobenzoate degradation
bxb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DR64_3304 (amnB)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.74  2-aminophenol 1,6-dioxygenase
     DR64_3304 (amnB)
    1.13.11.76  2-amino-5-chlorophenol 1,6-dioxygenase
     DR64_3304 (amnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigB
Motif
Other DBs
NCBI-ProteinID: AIP32713
UniProt: Q13VT6
Position
1:3599650..3600564
Genome map
AA seq 304 aa AA seqDB search
MNEGKILSGLLAPHPPHLVYGENPPQNEPRSQGGWEPLRWAYDQVRENIEHLKPDVLIVH
SPHWITQVGHHFLGVPRLTGRSVDPIFPNLFRYDFGMNVDVELAEACCEEATKLGLVSKM
MRNPSFRVDYGTITTLHMVRPQWDIPVVGISANNTPYYLNTKEGLGEMDLLGRATREAIR
KTGRRAVLLASNTLSHWHFHEEPALPEDMSKEHPERYDGYLWDVRMIELMRKGHMKEVFE
LLPQFIEEAFAEIKSGAFTWMHAAMGYPELAGKLHGYGTVIGTGNAVIEWNLEDVGLSRL
ESVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaggcaagattctgtccggcctcttggcgccccatccgccgcatctggtctat
ggggagaacccgcctcagaacgaaccgaggtcgcaaggcggctgggaaccgctgcgctgg
gcctacgatcaagtgcgcgagaacatcgagcatctgaagcccgatgttctgatcgtccat
tccccgcactggatcactcaggtgggccatcatttcctgggcgtacctcggcttacgggg
cgctcggtcgatcccatctttccgaatctgttccgctacgacttcggcatgaacgtcgat
gtggaactggccgaggcctgctgcgaggaagcaaccaagctgggtctggtcagcaagatg
atgcgcaacccgagcttccgcgtggactacgggaccatcaccacgctgcacatggtccgc
ccgcaatgggatatccccgtggtggggatctcggccaacaacacgccgtactacctcaac
accaaagaggggctgggcgagatggaccttctcggtcgtgccacgcgagaagctattcgg
aagacggggcggcgtgcagtccttctggcgagcaatacgctgtcgcactggcacttccat
gaggagcctgcgctgcctgaggacatgtccaaagagcacccggagcgctacgacggctac
ttgtgggatgtacgcatgatcgaactcatgcgcaagggccacatgaaggaagtcttcgaa
ctgctccctcagttcatcgaagaagcctttgctgaaatcaagtccggtgcattcacttgg
atgcacgcagcgatgggttatcccgaactggccggcaagctacatggctacggcaccgtc
atcggcactggcaacgcggtgatcgagtggaaccttgaggatgtcggcctttcccgtttg
gagtccgtggcgtaa

DBGET integrated database retrieval system