KEGG   Paraburkholderia xenovorans LB400: DR64_446Help
Entry
DR64_446          CDS       T03290                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00071  Fatty acid degradation
bxb00072  Synthesis and degradation of ketone bodies
bxb00280  Valine, leucine and isoleucine degradation
bxb00310  Lysine degradation
bxb00362  Benzoate degradation
bxb00380  Tryptophan metabolism
bxb00620  Pyruvate metabolism
bxb00630  Glyoxylate and dicarboxylate metabolism
bxb00640  Propanoate metabolism
bxb00650  Butanoate metabolism
bxb00900  Terpenoid backbone biosynthesis
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01120  Microbial metabolism in diverse environments
bxb01130  Biosynthesis of antibiotics
bxb01200  Carbon metabolism
bxb01212  Fatty acid metabolism
bxb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR64_446
   00630 Glyoxylate and dicarboxylate metabolism
    DR64_446
   00640 Propanoate metabolism
    DR64_446
   00650 Butanoate metabolism
    DR64_446
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DR64_446
   00072 Synthesis and degradation of ketone bodies
    DR64_446
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR64_446
   00310 Lysine degradation
    DR64_446
   00380 Tryptophan metabolism
    DR64_446
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR64_446
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR64_446
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DR64_446
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bxb04147]
    DR64_446
Enzymes [BR:bxb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR64_446
Exosome [BR:bxb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR64_446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ACP_syn_III Peptidase_M22
Motif
Other DBs
NCBI-ProteinID: AIP31475
UniProt: Q140N8
Position
1:complement(452009..453211)
Genome map
AA seq 400 aa AA seqDB search
MKAHNVAVIGVGQTEFRSRSDNQTYAELAQEAVALALVDANLQPEEIDAVVFSMAPTTFM
GVADADKWAVDYTWARGKPFMRVHTGGATGGSALQAAHAHVASGQYGTVLVVGADRITET
PDAQFVLNLIWDAFYEQDFALNTVTMTALATQRYMHKYGTTERQYANVVVRARRNALNNP
SAHLKGAIDIDAVLASPRISWPYKLFDICPRSAGAAAVVMTSETLARERCTRPAFITGTA
GVSNTIFMGDRMGPHADTDFADFAELRQAARECFRQAGITDPLRELQTVEIYDPFSSFQF
PQLESLGFCKPGTAQQLSDEGAFDMDGAIAVNPSGGTLCTNPIGVTGLVRAAEAARQVMG
RSAAMQVKNVHNALATAIGGSTQFFTVTMLSDEPRRAPAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcacaacgtagcggttatcggcgttggccagacggaattccggtcgcgctcg
gacaatcagacttacgccgaactcgcgcaggaggccgtcgcgctcgcgcttgtcgacgcc
aatctgcaacccgaggaaatcgacgcggtggtgttttcaatggcgccgaccaccttcatg
ggcgtcgcggacgcggacaaatgggcggtcgattacacctgggcgcgcggcaagccgttc
atgcgcgtgcacaccggcggcgcgaccggcggctccgcgttgcaggcggcgcacgcgcac
gtcgcgtccgggcagtacggcaccgtgctggtggtcggcgccgaccgcatcaccgaaacg
ccggacgcgcagttcgtgctgaacctgatctgggacgcgttctacgagcaggactttgcg
ctgaacacggtgaccatgacagcgctcgccacgcagcgctacatgcacaagtacggcacg
accgagcggcaatatgcgaatgtcgtggtacgtgcccgccgcaatgcgttgaacaatcct
tccgcgcatctgaagggcgcgatcgatatcgacgcggtactcgcgtcgccgcgcatttcg
tggccgtacaagctgttcgatatctgtccgcggtcggcgggtgcggcggcggtggtgatg
acgtccgagacgctcgcgcgcgaacgctgcacgcgcccggcgttcatcaccggcaccgcg
ggcgtgtcgaacacgatattcatgggcgatcgcatgggacctcacgccgacaccgacttc
gccgatttcgcggagttgcgccaggcggcgcgcgaatgtttccggcaggcgggcattacg
gatccgctgcgcgagttgcaaacggtcgaaatctacgacccattcagctcgttccagttt
ccgcagctcgaatcgctcggcttctgcaaacccggcacggcgcagcaactgagcgacgaa
ggcgcattcgacatggatggcgcgatcgccgtgaatccgtccggcggcacgctgtgcacg
aatccgatcggcgtgaccggtctcgtgcgcgcggcggaagcggcgcgtcaggtcatgggc
cgctccgccgcgatgcaggtcaagaacgttcacaacgcgctcgccaccgcgattggtggg
tcgacgcaatttttcacggtcacgatgctgagcgacgagccgcgccgtgccccggcggcc
tga

DBGET integrated database retrieval system