KEGG   Paraburkholderia xenovorans LB400: DR64_8611
Entry
DR64_8611         CDS       T03290                                 

Gene name
bphA3
Definition
(GenBank) biphenyl dioxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00621  Dioxin degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01220  Degradation of aromatic compounds
Module
bxb_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DR64_8611 (bphA3)
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AIP35202
UniProt: P37332
Structure
PDB: 
1FQT

Position
3:1289298..1289627
AA seq 109 aa
MKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDV
VECSLHMGKFCVRTGKVKSPPPCEALKIFPIRIEDNDVLVDFEAGYLAP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaaatttaccagagtttgtgatcgaagagatgtgcccgaaggcgaagccctgaaggtc
gaaagtggaggcacctccgtcgcgattttcaatgtggatggcgagctgttcgcaacacag
gaccgctgcacccacggcgactggtccctgtccgatggcggctatcttgaaggtgacgtg
gtggaatgctcactgcacatggggaagttttgcgttcgcacgggcaaggtcaaatcaccg
ccgccctgtgaggcactgaagatatttccgatccgcatcgaagacaatgacgtgctggtc
gacttcgaagccgggtatctggcgccatga

DBGET integrated database retrieval system