KEGG   Paraburkholderia xenovorans LB400: DR64_8613
Entry
DR64_8613         CDS       T03290                                 

Gene name
bphB
Definition
(GenBank) cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00621  Dioxin degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01220  Degradation of aromatic compounds
Module
bxb_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DR64_8613 (bphB)
Enzymes [BR:bxb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     DR64_8613 (bphB)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD TrkA_N Epimerase bMG3 Polysacc_synt_2
Other DBs
NCBI-ProteinID: AIP34300
UniProt: P47227
Position
3:1290897..1291730
AA seq 277 aa
MKLKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNVLGIVGDV
RSLEDQKQAASRCVARFGKIDTLIPNAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYI
HAVKACLPALVASRGNVIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAPYVRVN
GVGSGGINSDLRGPSSLGMGSKAISTVPLADMLKSVLPIGRMPEVEEYTGAYVFFATRGD
AAPATGALLNYDGGLGVRGFFSGAGGNDLLEQLNIHP
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaactgaaaggtgaagcggtactgatcacggggggcgcctccggattagggcgcgcg
ctcgtggaccgattcgtggccgaaggcgccaaagtggcggtgctcgacaagtcggcagag
cgccttgcagagctggaaaccgatcatggcgacaacgtgctcggcatcgtcggcgatgtg
cgttcactggaagaccagaaacaggctgccagccgctgcgtggccaggttcgggaaaatc
gacaccttgattcccaatgcaggcatctgggattactcgacggccttggtcgacctgccc
gaagagagcctcgatgccgcgttcgatgaggtctttcacatcaatgtcaagggttatatc
catgcagtgaaggcctgcctgccggccctggtcgccagccgtggcaacgtgatcttcacg
atctccaatgcgggcttctatcccaatggcggcggccctctttacaccgcagccaagcac
gccatcgtgggcctggtgcgtgaactggcgttcgagctggcgccatacgtgcgcgtcaac
ggcgtggggtcgggcggcatcaatagcgatctgagaggtccttcctcgctgggaatgggc
agcaaggcgatttcgaccgtaccgctggccgacatgctgaagtcggtgctgccgattggt
cgcatgcccgaggtcgaagagtacaccggggcctatgtgttttttgccacccgaggcgat
gcggcgcctgcgaccggggccttgctgaactacgacggtggcttgggcgttcgtggattc
ttctcgggtgccggaggtaatgacttgctcgaacagctgaatatccatccctaa

DBGET integrated database retrieval system