KEGG   Paraburkholderia xenovorans LB400: DR64_8618Help
Entry
DR64_8618         CDS       T03290                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00362  Benzoate degradation
bxb00621  Dioxin degradation
bxb00622  Xylene degradation
bxb01100  Metabolic pathways
bxb01120  Microbial metabolism in diverse environments
bxb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR64_8618 (dmpG)
   00622 Xylene degradation
    DR64_8618 (dmpG)
   00621 Dioxin degradation
    DR64_8618 (dmpG)
Enzymes [BR:bxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     DR64_8618 (dmpG)
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     DR64_8618 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AIP35186
UniProt: P51015
Position
3:1295112..1296152
Genome map
AA seq 346 aa AA seqDB search
MKLEGKKVTVHDMTLRDGMHPKRHQMTLEQMKSIACGLDAAGIPLIEVTHGDGLGGSSVN
YGFPAHSDEEYLGAVIPLMKQAKVSALLLPGIGTVEHLKMAKDLGVNTIRVATHCTEADV
SEQHITQSRKLGLDTVGFLMMAHMASPEKLVSQALLMQGYGANCIYVTDSAGYMLPDDVK
ARLSAVRAALKPETELGFHGHHNLAMGVANSIAAIEAGATRIDAAAAGLGAGAGNTPMEV
FIAVCARMGIETGVDVFKIQDVAEDLVVPIMDHVIRIDRDSLTLGYAGVYSSFLLFAKRA
SAKYGVPARDILVELGRRGMVGGQEDMIEDTAMTMARERGLTLTAA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagctagaaggcaaaaaagtcaccgtccacgacatgacgctgcgcgacggcatgcac
cccaagcgccaccagatgacgctggagcaaatgaaatccatcgcctgcggcctggatgcc
gcgggcatcccgctgatcgaagtcacccacggcgacggcctgggcggctcctccgtcaac
tacggctttccggcgcacagcgacgaggaatacctgggcgccgtgattccgttgatgaag
caggccaaggtcagtgccctgctcttgcccggcatcggcaccgtcgaacacctgaagatg
gccaaggacctgggcgtgaacaccatccgcgtggccacccactgcaccgaagccgatgtg
tcggagcagcacatcacccaatcgcgcaagctgggtctggacaccgtgggctttttgatg
atggcgcacatggccagcccagaaaagctggtcagccaggcactcttgatgcaaggctac
ggcgccaactgcatctacgtcaccgactcggccggctacatgctgcctgacgacgtgaaa
gcgcgcctgagtgccgtgcgtgccgcgctcaaacccgaaaccgagttgggctttcacggc
catcacaacctggccatgggcgtcgccaactcgatcgccgcgatcgaggccggggccacc
cgcatcgatgccgctgccgctggcctgggtgccggcgccggcaacacgccgatggaggtg
ttcatcgccgtatgcgcgcgcatggggatcgaaaccggagtcgatgtgttcaagatccag
gacgtggccgaagacctggtggtgccgatcatggaccatgtcatccgcatcgaccgcgac
tcgctcacgctgggctatgccggggtctattccagctttctgctgtttgccaaacgcgcc
agtgcgaagtacggcgtgccggcgcgcgacatcctggtcgagctgggacggcgcggcatg
gtcggcggccaggaagacatgattgaagacaccgccatgaccatggcacgtgagcgcggg
ttgaccttgaccgccgcatga

DBGET integrated database retrieval system