KEGG   Paraburkholderia xenovorans LB400: DR64_8710Help
Entry
DR64_8710         CDS       T03290                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb00051  Fructose and mannose metabolism
bxb00520  Amino sugar and nucleotide sugar metabolism
bxb01100  Metabolic pathways
bxb01110  Biosynthesis of secondary metabolites
bxb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DR64_8710
   00520 Amino sugar and nucleotide sugar metabolism
    DR64_8710
Enzymes [BR:bxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DR64_8710
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     DR64_8710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding UDPGP
Motif
Other DBs
NCBI-ProteinID: AIP34919
UniProt: Q13G32
Position
3:1404952..1406478
Genome map
AA seq 508 aa AA seqDB search
MSHTSVGEAEVACGESEVVRTEKSTAALATRLVPVVLAGGAGSRLWPMSREHYPKQLIDV
LGSDSLLQATVQRMEGFRADGSMVSAPIIVCGDEHRFVTSEQLRARGIDARIVVEPARRD
TAPALTIAAADLCSEGDDAIIVAMPADHAIENLVAFHSAIAVAVQHAQRGAIVTLGVPPT
RPDTGFGYIRLGSELGRGAHRIASFVEKPAAELAEQYLASGRYWWNSGIFAVRASVWLAM
LRIMQPVMHDACVLAHAQGTHDGAYFRPGADAFKSSPADSIDYAVMERLGSDERFADGVV
VPLDAGWSDLGSWDAVWEALDKDADGNAARGRVVFEGTTSSFAHSQGRLIACVGLTNVVV
VETDDAVLVADRSRVQEVKSVVSRMRALQAPEVDAHRKVRRPWGYYDSIDHGERFQVKRI
VVNPGGRLSLQLHHHRAEHWIVVSGTALVTRGNEEFMLSENQSTFIPLGVTHRLENPGKL
PLELIEVQSGPYLGEDDIVRFDDTYGRA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatacgtcagtgggtgaggcggaagttgcctgcggtgaaagcgaggtcgtccgg
acggaaaagagtaccgctgcattggccacgcgactcgtacctgttgtgctggcgggcggg
gctggttcgcgactgtggcccatgtcacgcgaacactatccgaaacaactgatcgacgtg
ctgggatccgattcgctgctacaagccaccgtgcagcggatggaaggcttccgcgccgat
ggaagcatggttagcgcgccgattatcgtgtgcggggacgaacaccgcttcgtcacgtcg
gagcaactccgcgcgaggggaatcgatgcgcgcatcgtggtcgagccggcgcggcgcgat
actgcgccggcgctgacgatcgccgcagcggatttgtgctcggagggcgacgacgcgatc
attgttgcaatgccggcggatcacgcgatcgagaacctcgtggcttttcattcagcgatc
gcagtggcggtgcagcatgcgcagcgcggcgccattgtgacactgggagtgccgccgacg
cgccccgacacgggctttggttatatcaggctgggttctgagctcggccgtggtgcacat
cgtatcgcgagtttcgtcgaaaaacccgcagccgaattggccgagcagtatctcgcgtcg
ggccggtactggtggaacagcggcatattcgcagtgcgggcgagcgtgtggcttgccatg
ctcaggatcatgcaaccggtgatgcatgacgcgtgtgtattggcccacgcacagggtact
cacgacggcgcgtatttccgcccaggcgcggacgctttcaagtcttctccggcggattcg
attgattatgcggtgatggagcgtctcggatcggacgagcggttcgcggacggcgtggtg
gtaccgcttgatgcagggtggtcggatcttgggtcatgggatgcggtgtgggaagcgctc
gataaggacgcggacggcaacgccgcgcgcggaagggtcgtgttcgaaggtacgacatcc
agctttgcccactcgcaggggcgcctcattgcatgtgtcggcctgaccaacgtggtcgtt
gtggagaccgacgacgccgtgctggtcgccgaccgctcgcgcgtacaggaagtaaagagc
gtggtcagccggatgagagcgctgcaggcacccgaggtcgacgcgcaccggaaggtacgg
cgcccatggggttactacgactcgatcgatcacggcgaacgttttcaggtaaagcggatc
gtcgtgaacccgggcggccgcctgtcgttgcaattgcatcaccatcgcgccgagcactgg
atcgtggtgagtggcacggcgctggtgacacgcggcaacgaggaattcatgctcagcgag
aaccagtcgaccttcattccactgggcgtgacgcatcgcctggagaatccgggcaagttg
ccgctcgaactcatcgaagtgcagtccggaccgtatcttggcgaagacgacatcgttcgt
tttgacgatacatacggtcgcgcttga

DBGET integrated database retrieval system