KEGG   Paraburkholderia xenovorans LB400: DR64_991Help
Entry
DR64_991          CDS       T03290                                 

Gene name
msbA
Definition
(GenBank) lipid A export permease/ATP-binding protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
bxb  Paraburkholderia xenovorans LB400
Pathway
bxb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bxb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DR64_991 (msbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxb02000]
    DR64_991 (msbA)
Enzymes [BR:bxb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     DR64_991 (msbA)
Transporters [BR:bxb02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    DR64_991 (msbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_29 DEAD RsgA_GTPase AAA_22 AAA NTPase_1 AAA_24 T2SSE AAA_25 AAA_18 AAA_30 AAA_28 TsaE Zeta_toxin PRK
Motif
Other DBs
NCBI-ProteinID: AIP33801
UniProt: Q142P6
Position
1:complement(1040841..1042634)
Genome map
AA seq 597 aa AA seqDB search
MSAKPTLSKPIGSGEASSPAVVFRRLWPYIKPLIWVLIGAIVAMAVSAATDAAIPALLKP
LLDKGFGAHANDRAKWFVPAAVIGLALIRSLSQYASGYLLAYVTNKILLDLRLKMFDRMI
HTSVAFFQRETASTVINAIVFEVNQILNVLLSVLVTLVRDSLTVVFLLGYLFYLNWRLTL
IVAVLLPAIGWLVGKINRRLRRLNREHQLLTNELSYIVEESVGGYKVVKVHNGEQYEMDR
FESMSKRLRGYAMRMTVSGGLAQPLTQFLASIALAVVITIAVVQSSSDQTTVGGFVAFVT
SMLLIISPLKHLMDVNQPLQRGMTACEMIFGLIDEPSEPEGGGKPLERAHGAVEFRDVSF
VYSGNATHNRHTLDQISFRVAPGEMIALAGPSGSGKTTLVNLLPRFFDPTGGQILVDGVA
IPEYDLHALRSQIAMVSQDVVLFNDTVANNVAYGQTADAGKVKAALRAANLWDTVEAMPK
GIETLVGDNGMMLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMK
GRTTLVIAHRLSTIERADRILVMEAGRIVESGSHRELLAQDGLYAHLHRIQFQQSAA
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcgaagccaacgttaagcaaacccatcggttcaggtgaggcgtcgtcgcccgcc
gtcgtctttcgacgtttgtggccgtacatcaagccgctgatctgggtcctgattggcgcg
atcgtcgcaatggccgtcagcgccgcgaccgacgccgcgatccccgcgctgctcaagcct
ttgctggacaagggtttcggcgcgcatgccaacgacagggccaagtggttcgtgccggcc
gcggtgattggcctcgcattgattcgcagcctgtcgcaatacgcgtccgggtatctgctt
gcctacgtgacgaacaagatcctgctcgacctgcgcctgaagatgttcgaccgcatgatt
cacacgagcgtcgcgttcttccagcgcgaaaccgcgagtacggtgatcaacgcgatcgtg
ttcgaggtgaaccagattctcaacgtgctgctgagcgtgctggtcacgctggtgcgcgat
tcgctgaccgtggttttcctgctcggctatctgttctatctgaactggcgtttgacgctg
atcgtcgcggtgctgctgccggcgatcggctggctggtcggcaagatcaaccgccggctg
cgccgcctgaaccgcgagcatcaactgctgaccaatgagctgtcgtacatcgtcgaagag
tcggtgggcggctacaaggtcgtcaaggtccacaacggcgaacagtacgagatggaccgc
ttcgagtcgatgagcaagcgtctgcgcggctatgccatgcgcatgacggtgtccggtggt
ctcgcgcagccgttgacgcagttcctcgcgtcgatcgcgctcgcggtggtgatcacgatc
gcggtggtgcagtcgtcgtcggatcagaccacggtgggtgggttcgtcgcgttcgtcacg
tcgatgctgctcatcatctcgccgctcaagcacctgatggacgtgaaccagccgctgcag
cgcggcatgacggcgtgcgaaatgatcttcggcctgatcgacgaaccgtccgagccggaa
ggcggcggcaaaccgctcgaacgcgcgcacggcgcggtggaattccgcgacgtctcgttc
gtgtatagcggcaacgccacgcacaaccgccacacgctcgaccagatctcgttcagggtg
gcgccgggcgaaatgatcgcgctcgcgggcccgtcgggtagcggcaagaccacgctggtg
aatctgctgccgcgctttttcgatccgaccggcggccagattctggtcgacggcgtggcg
atccccgaatacgatctgcacgcgctgcgcagccagatcgcgatggtgagccaggacgtg
gtgctgttcaacgacacggtcgccaataacgtcgcgtacgggcagaccgccgacgccggc
aaggtcaaggcggccctgcgcgcggccaacctgtgggacaccgtcgaggccatgccgaag
ggcatcgagacgctggtcggcgacaacggcatgatgctctcgggcggccagcggcagcgt
ctcgcgatcgcgcgcgcgatctacaaggacgcgccgatcctgatcctcgacgaagcgacg
tcggcgctggactcggaatccgaacgccacgtgcaggccgcgctggaaacgctgatgaag
ggccgcacgaccctggtcatcgcgcaccggctgtcgaccatcgagcgcgccgaccggata
ctggtgatggaagcggggcggatcgtcgagagcggcagtcatcgcgaactgctggcgcaa
gacgggctgtacgcgcatctgcaccgcatccagttccagcagagcgcggcgtaa

DBGET integrated database retrieval system