KEGG   Paraburkholderia xenovorans LB400: Bxe_A0464Help
Entry
Bxe_A0464         CDS       T00340                                 

Definition
(GenBank) Protein ApaG, Mg2 efflux/Co2 resistance-related protein, CorD-like protein
  KO
K06195  ApaG protein
Organism
bxe  Paraburkholderia xenovorans LB400
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Bxe_A0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABE32469
UniProt: Q13TX0
Position
1:complement(4375748..4376122)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSTQVQYLPEESDPERRQYAFAYTLTIRNTGQVPAQLIARHWVITDSDKNVQE
VKGLGVVGHQPLLKPGEHFEYTSWAVIATPVGTMRGEYFCVAEDGERFDAPVPEFILRMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaattcagcgtctcgacgcaggtgcaatatctgcccgaagagtcggac
ccggagcgccgccagtatgcattcgcatacacgctgactatccgtaacaccggccaggtg
cccgcgcagttgatcgcgcggcattgggtcatcacagacagcgacaagaacgtgcaggaa
gtgaagggtcttggcgtggtcggccatcagccgctgctcaaaccgggcgagcatttcgag
tacacgagttgggcggtgatcgccacaccggtcggcaccatgcgcggagaatacttctgt
gtggccgaggacggcgagcggttcgatgcgccggtgccggagttcatcctgcgcatgccg
cgtacgttgcattga

DBGET integrated database retrieval system