KEGG   Paraburkholderia xenovorans LB400: Bxe_A0510Help
Entry
Bxe_A0510         CDS       T00340                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00330  Arginine and proline metabolism
bxe00332  Carbapenem biosynthesis
bxe01100  Metabolic pathways
bxe01130  Biosynthesis of antibiotics
bxe01230  Biosynthesis of amino acids
Module
bxe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bxe_A0510
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Bxe_A0510
Enzymes [BR:bxe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bxe_A0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABE32423
UniProt: Q13U16
Position
1:complement(4316116..4317234)
Genome map
AA seq 372 aa AA seqDB search
MRSVIADSRRLVVKVGSSLVTNDGRGLDHAAIGRWAGQIAALRAQGKEVVLVSSGAIAEG
MQRLGWTRRPREIDELQAAAAVGQMGLAQVYESRFAEHSIQTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALVILTDQQGLFT
ADPRKDPAATLVQQADAGAPELEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
REVDVLSRLASGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDDGAVEKLTEGGKSL
LPIGIVGVQGAFARGEVIACLSAAGREVARGLTNYSSAETKLIQRRPSGEIESVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgtcatcgcagattcacggcgattggtagtgaaagtgggttcgagcctcgtc
acgaatgacgggcgcggcctcgatcatgccgctatcggccgctgggccggacagattgcc
gcgctgcgcgcgcaaggcaaggaggtggtgctcgtgagttcgggcgccatcgccgaaggg
atgcaacggctcggctggaccaggcggcctcgcgaaatcgacgaactgcaggcggccgcg
gccgttggccagatgggtctcgcacaggtctacgaaagccgctttgccgagcattccatt
cagaccgcgcagattctgctgactcacgccgaccttgccgaccgcgaacgctatctgaat
gcgcgctccacgctgctcacgctgttgcgcctgggcgtggtgccgatcatcaacgagaac
gacacggtcgttaccgacgaaatcaaattcggcgacaacgacacgttgggcgcactcgtc
gcgaacctgatcgagggggacgcactcgtcatcctcaccgatcagcaagggctctttacc
gccgacccgcgcaaggatccggccgccaccctcgtccagcaggccgatgccggcgcgccg
gaactggaagcaatggcgggcggcgcgggttcgagcctcgggcgcgggggcatgctgacc
aagattctggccgccaagcgtgcggctcacagcggcgcgaatacggtgatcgcgagcggg
cgcgaagtggacgtgctgtcgcggctcgcttcgggcgaggcgatcggcacgcagttgatc
gcacgcacggcacggatggcggcgcgcaagcaatggatggcggatcatctgcaggtgcgt
ggtcacgtggtgatcgacgacggcgcagtcgaaaaactcaccgaaggcggcaagagcctg
ctgcccattggtatcgtcggcgttcagggcgcgtttgcgcgcggtgaggtgattgcctgt
ctgagcgccgcggggcgagaagtggcgcgcggactgaccaactacagcagcgctgaaacc
aagctgatccagcggcggccgagtggcgaaatcgaatcggtgcttggctacatgctggag
cctgagttgattcaccgcgacaacctggtgctggtctga

DBGET integrated database retrieval system