KEGG   Paraburkholderia xenovorans LB400: Bxe_A0616Help
Entry
Bxe_A0616         CDS       T00340                                 

Definition
(GenBank) DNA recombination protein, RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bxe_A0616
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bxe_A0616
DNA repair and recombination proteins [BR:bxe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bxe_A0616
    RecFOR pathway proteins
     Bxe_A0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 HHH_3 Transposase_20 Cdd1 IMS_HHH 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: ABE32318
UniProt: Q13UC1
Position
1:4200212..4200793
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGVLLEKNPPHLLVDCNGVGYEVDVPMSTFYNLPSTGERVVLLTQMIVREDAHLL
YGFGTAEERSTFRELLKISGIGARMALAVLSGMSVHELAQTVTMQDAARLTRVPGIGKKT
AERLLLELKGKIGADLGAMAGAASASDHASDILNALLALGYSEKEALAAVKNVPAGTGVS
EGIKLALKALSKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcattgccggcgttctgctggaaaaaaacccgccgcatctgctcgtcgac
tgcaacggcgtcggttacgaagtcgatgtgccgatgagcacgttctacaacctgccctcc
accggcgaacgcgtggtgttgctcacgcagatgatcgtgcgcgaagacgcacacctgctc
tacggcttcggcaccgccgaggaacgctcgaccttccgcgaactgctgaaaatctccggc
atcggcgcacgcatggcgctggcggtgctgtcgggcatgagcgtccacgagctcgcgcaa
accgtcacgatgcaggacgcggcgcgtctgacgcgcgtgccgggcatcggcaagaagacg
gcggagcggctgctcctcgaactgaagggcaagatcggcgcagacctgggcgcaatggcg
ggcgcggcgtcggcatccgaccacgcctccgacattctgaacgcactactcgcattgggt
tactccgaaaaagaagcgttggccgccgtcaagaacgtgccggccggcaccggcgtttcc
gagggcatcaagctcgcattgaaggcgctgtccaagggctga

DBGET integrated database retrieval system