KEGG   Paraburkholderia xenovorans LB400: Bxe_A1180
Entry
Bxe_A1180         CDS       T00340                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
bxe  Paraburkholderia xenovorans LB400
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ABE31773
UniProt: Q13VW6
Position
1:3606287..3607234
AA seq 315 aa
MTRAFDLMRRLRAGVASVLLLSATGSYALNTATIVGSVASPDCLEYRVVGICYWLYCTWT
GCTVRTSIKVRHYIPDAVVSSYSNTGENPWIEVRPMSTPNPSAQAGGDGTTNEDHENNLA
KFKNADVIGHPGAEVFNQFVSSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEAL
IPGMREVGARTTMNLWGNVYPRGGFLHQTDDHKTGAVIAQRAGDVVTRRGQLHVYQPLLA
NPRDGYWPAGALMEGDASTGKWQELTPVLSSSCSVFPRSGSLTQAQQGDYAWALWRPYAC
CERRGQVFLGSVDFL
NT seq 948 nt   +upstreamnt  +downstreamnt
gtgactcgtgcattcgacctgatgcgccgcctgcgtgctggcgtggcgtccgtgctgctg
ctcagcgccacgggcagctacgcgctcaacaccgcaaccatcgtcggctcggtggcatct
ccagactgcctcgaataccgcgtcgtcgggatctgctactggctctactgtacctggacg
ggctgtacggtacgcacgtccatcaaggtccgccactacatccccgatgcggtcgtctcc
agctacagcaacaccggcgaaaacccctggatcgaagtccggccgatgagcacgcccaac
ccatccgcccaagccggcggggacggaacgacgaacgaggaccacgaaaacaacctcgcc
aagttcaagaatgcggacgtcatcggccacccgggcgccgaggtgttcaaccagttcgtg
tcgtcctcgggctacttctgcgagggtgcgggcacggcgttcatgccgtacttgctcagc
accctggacacgctggcctggcgctacaacgtgcccgagatggcctacccggaggcgctg
attcctggcatgcgcgaggtcggcgcacgcaccacgatgaacctctggggcaacgtgtat
ccccgcggtggttttctgcaccagaccgacgaccacaagaccggcgcagtgatcgcccag
cgcgcaggcgatgtcgtcacgcgccgcgggcaactccacgtctatcagccgttgcttgcc
aacccccgcgatggctactggccggctggcgcgctgatggagggcgatgcctcgacaggc
aagtggcaggaactcacacccgtcctgtcatcgtcctgctcggtcttcccgcgcagcggc
tccctgacccaggcccagcagggcgattacgcctgggcgctatggcggccgtatgcgtgc
tgcgaacgccggggccaagtgtttctcggcagcgtcgatttcctctga

DBGET integrated database retrieval system