KEGG   Paraburkholderia xenovorans LB400: Bxe_A1189Help
Entry
Bxe_A1189         CDS       T00340                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
bxe  Paraburkholderia xenovorans LB400
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 TraL
Motif
Other DBs
NCBI-ProteinID: ABE31764
UniProt: Q13VX5
Position
1:3597505..3597915
Genome map
AA seq 136 aa AA seqDB search
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTI
ALAPTFVVLGVAFGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLVAGWVGGHVLIS
RSGFWTTRRSAARGSR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcagcagcacgtccgtgctgacgggacggtcacgttccttccgcaccggctc
aaccgccatcccgttgttgtgcgcggcctcaccgccgacgagctgtggatctgctgcggc
ctgtccggcgccgccggcctgctggtcggtgcgccgctgtcctgggtgttccgcacgatc
gcgcttgcacccacgttcgtcgtgctgggcgtggccttcggcgtgttcatcgggggcggc
atcctgcgtcgcctcaagcgtgggcgtcccgacacctggctgtatcggcaactccagtgg
cgcatcgccacgcgccacccgctggtggcaggctgggtgggcggccatgtactgatctca
cgctccggcttctggaccacccgaaggtctgcagcaagggggtcacgatga

DBGET integrated database retrieval system