KEGG   Paraburkholderia xenovorans LB400: Bxe_A1195Help
Entry
Bxe_A1195         CDS       T00340                                 

Definition
(GenBank) hypothetical protein
Organism
bxe  Paraburkholderia xenovorans LB400
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Motif
Other DBs
NCBI-ProteinID: ABE31758
UniProt: Q13VY1
Position
1:3592944..3595130
Genome map
AA seq 728 aa AA seqDB search
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYR
DARVILRYRRNIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYV
EPTPAYRLTRRLEERLEFARFPLSRLPKLTGWDVPFNPVRPLPPVGGLPRLHGIEPEEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRKNAAGEHEVVIVIDPKGDADLLKR
MYVEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAIVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMSSVPMIEPSHIVGLPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPQDLQQLAGYMRQSYSEATQWWEFTSSPALQDGALPDDLLDDAAAVEPGLVATDD
SAGNEASP
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggaaacagccggtcgaggtgctgcttcgcccagcggtggagctatataccgtc
gcggcgtgtgcgggcgccgcgtttctgtccctggtggccccgtggtcgctcgcgctgagc
cccgccatgggtgtcggcagcgcgttggcgttcggggcctatggcgcgatccgctaccgc
gatgcccgcgtcatcctgcgctaccggcgcaacatccgccgcctgccgcgctacgtgatg
accagcaaggacgtgccggtcagccagcaacgtctgtttgtggggcgcggctttttgtgg
gagcagaaacacacccataggctcatgcagacataccggccggagtttcggcgctacgtc
gagccgacgccggcctaccgactgacgcggcgcctggaggaacggctggagttcgcgcgg
ttcccgctttcccggctgccgaaactcaccggctgggacgtgcctttcaacccagtgcgc
ccgctgccgcccgtgggcggactgcctcggctgcacggcatcgaacccgaggaggtggac
gtcagcctgccgctcggcgagcgcgtcgggcactcattggtcttggggacaacccgcgtg
ggcaagacgcggctggccgaactgttcgtgacccaggacatccggcgaaagaacgcggcg
ggagagcacgaggtcgtgatcgtcatcgaccccaaaggggatgccgatctgctgaagcgg
atgtacgtcgaggcgcaacgcgcgggccgcgagggcgagttctatgtcttccatttgggc
tggccggacatttccgcccgctacaacgccgtggggcgctttggacgtatcagcgaggtg
gcgacccgcattgcagggcaactctccggtgaaggcaactcggcggctttcagggaattt
gcctggcgcttcgtcaacatcatcgcccgcgccttggtggaactggggcagcgtccggac
tacatgctgatccagcggcatgtcatcaacatcgacgcgctgttcatcgagtacgcccag
cactacttcgccaagacggagccgaaagcctgggaggtgatcgtccagatcgaggccaag
ctcaacgagaagaacatcccgcgcaacatgatcgggcgcgagaagcgcgtggtggcgctg
gagcagtacctgtcccaagcccgcaactacgaccctgtgctggacggtttgcgctctgcc
gtgcggtacgacaagacgtatttcgacaagatcgtcgccagcctcttgcctctgctggaa
aaactcacgagcggcaagatcgcgcagctcctggccccgaactattccgacctggccgac
ccgcgcccgatcttcgattggatgcaggtcattaggaagcgggccatcgtctatgtgggc
ctggacgcgctgtccgatgccgaggtcgccgcagcggtcggcaactcgatgttcagcgat
ctcgtctcggtcgcaggccatatctacaagcacgggatcgacgatggcctgccgggcgct
tcggccggcgcgcgcgtgccgatcaacgtccatgccgatgagttcaacgagttgatgggt
gacgagttcattccgctgatcaacaaaggtggtggcgccgggctgcaagtcaccgcgtac
acgcagaccctctcggacattgaggcccgcattggcaaccgcgccaaggccggtcaggtc
atcggcaacttcaacaacctgttcatgctgcgcgtgcgcgagaccgcgaccgctgaactg
ctgacccggcaactaccgaaggtcgaggtttatacgaccaccatcgtcagcggcgcgacc
gacagctcggacattcgcggggcgacggatttcacgtccaacactcaggaccgcatcagc
atgtccagcgtgccgatgatcgagccgtcgcacatcgtcggcttgcccaagggccagtgt
tttgcattgttgcagggcggccaactttggaaggttcgcatgccgctgccggcaccggac
cccgatgaggtcatgccacaggatctgcaacaactcgcgggctacatgcgccagagctac
agcgaggccacgcagtggtgggagttcaccagctccccggcgctgcaggacggggccttg
cccgacgacctgctggatgatgctgctgcggtcgaacctggccttgtggccaccgacgac
agcgccggcaacgaggcctcgccatga

DBGET integrated database retrieval system