KEGG   Paraburkholderia xenovorans LB400: Bxe_A1651Help
Entry
Bxe_A1651         CDS       T00340                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00630  Glyoxylate and dicarboxylate metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01200  Carbon metabolism
Module
bxe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_A1651
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bxe_A1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABE31304
UniProt: Q13X85
Position
1:3085577..3086881
Genome map
AA seq 434 aa AA seqDB search
MSRQEQAKQLQQQWETDPRWKGVKRSYTAEDVIRLRGSVQVEHTLAKRGAQKLWESVNNE
PFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGV
HFEDQLASVKKCGHMGGKVLVPTRENIAKLTAARLAADVSGVPTVLLARTDAEAADLITS
DIDENDKPFLTGERTVEGFYRTKPGLEQAISRGLAYAPYADMIWCETGKPDLEFAKKFAD
AIHKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARNQMTAFVEMQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDKRVA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcaggaacaagccaaacaacttcagcagcaatgggaaacggatccgcgctgg
aaaggcgtgaagcgcagctacacggcggaagacgtgatccgcctgcgcggttcggtgcag
gtcgagcacacgctcgccaagcgcggcgcgcaaaagctgtgggaaagcgtgaacaacgag
ccgttcgtcaactcgctcggcgcgctgaccggcaaccaggccatgcaacaggtcaaggcc
ggcctcaaggcgatctatctgtccggctggcaagtcgcgggcgacgcgaacgtggccggg
gaaatgtatccggaccagtcgctgtatccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctgacgcgtgccgaccagatccagtggtcggaaggcaagaacccgggc
gacgaaggctatatcgactacttcgcgccgatcgtggcggatgcggaagcgggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaagcgggcgctgccggcgtg
cacttcgaagaccagctcgcctccgtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacccgcgaaaacatcgccaagctgaccgccgcgcgtctggccgccgacgtctcg
ggcgtgccgaccgtgctgctggcgcgtaccgatgcggaagccgccgacctgatcacctcg
gacatcgacgaaaacgacaagccgttcctgaccggcgagcgcacggtggaaggcttctac
cgcacgaagccgggtctcgaacaggcaatctcgcgtggcctcgcctacgcgccgtacgcc
gacatgatctggtgcgaaaccggcaagccggacctcgagttcgcgaagaaattcgccgac
gcgatccacaaggaatacccggatcaactgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctggacgacgcaacgatcgccaagttccagcgcgaactcggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatgttc
aacctcgcgcacggctatgcccgcaaccagatgaccgccttcgtcgaaatgcagcaggct
gaattcgctgcggccgaaaagggcttcaccgcagtcaagcaccagcgcgaagtcggcacc
ggctacttcgatgccgtgacgcaaacggtcgaacgcgaagcatcgacgaccgcgctgcac
ggctcgacggaagacgaacagttcttcgacaagcgggtcgcgtaa

DBGET integrated database retrieval system