KEGG   Paraburkholderia xenovorans LB400: Bxe_A1665Help
Entry
Bxe_A1665         CDS       T00340                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00480  Glutathione metabolism
bxe00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bxe_A1665
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bxe_A1665
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bxe_A1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABE31290
UniProt: Q13X99
Position
1:complement(3069518..3069997)
Genome map
AA seq 159 aa AA seqDB search
MTSIYSFSARTLGGEEVSLEQYSGKVLLIVNTASECGFTPQYAGLQKLYETYAARGLAVL
GFPCNQFGKQEPGDAAQIGSFCEKNYGVTFPMFDKVDVNGANAHPLFRYLTGEAPGVLGL
EAIKWNFTKFLIDREGNVVKRYAPLTKPEAITEDIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgatctattcgttttcggcacgcacgctcggcggcgaggaagtgagcctcgag
caatatagcggcaaggttttgctgatcgtcaacacggcgagcgaatgcgggttcacgccg
caatacgccggcttgcagaagctgtacgagacctacgcggcgcgcgggctcgcggtactc
ggttttccgtgcaaccagttcggcaagcaggagccgggcgacgcagcgcagatcggcagc
ttctgcgaaaagaattacggcgtgacgttcccgatgttcgacaaggtggacgtgaacggt
gcgaacgcgcatccgctattccgttatctgacgggcgaggcgccgggcgtgctgggtctc
gaggcgatcaagtggaatttcaccaagtttctgatcgaccgtgagggcaatgtggtgaag
cgttacgcgccgctgacgaagcccgaggcgattaccgaggacatcgaaaagctgctgtga

DBGET integrated database retrieval system